BLASTX nr result
ID: Coptis21_contig00029242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029242 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282776.1| PREDICTED: uncharacterized protein LOC100267... 64 1e-08 ref|XP_003533932.1| PREDICTED: uncharacterized protein LOC100787... 64 2e-08 ref|XP_003533094.1| PREDICTED: uncharacterized protein LOC100815... 64 2e-08 ref|XP_003523243.1| PREDICTED: uncharacterized protein LOC100526... 64 2e-08 ref|XP_002522204.1| heat shock protein binding protein, putative... 62 4e-08 >ref|XP_002282776.1| PREDICTED: uncharacterized protein LOC100267710 [Vitis vinifera] gi|296088617|emb|CBI37608.3| unnamed protein product [Vitis vinifera] Length = 285 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +3 Query: 3 HPDKHQGPSQAPAEEKFKQCVNAYKALCNAL 95 HPDKHQGPSQA AEEKFK CVNAYK+LCNAL Sbjct: 252 HPDKHQGPSQATAEEKFKLCVNAYKSLCNAL 282 >ref|XP_003533932.1| PREDICTED: uncharacterized protein LOC100787858 [Glycine max] Length = 262 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 HPDKHQGPSQAPAEEKFKQCVNAYKALCNAL 95 HPDKHQGPSQA AEEKFK CVNAYK LCNAL Sbjct: 229 HPDKHQGPSQAMAEEKFKLCVNAYKTLCNAL 259 >ref|XP_003533094.1| PREDICTED: uncharacterized protein LOC100815841 [Glycine max] Length = 160 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 HPDKHQGPSQAPAEEKFKQCVNAYKALCNAL 95 HPDKHQGPSQA AEEKFK CVNAYK LCNAL Sbjct: 127 HPDKHQGPSQAMAEEKFKLCVNAYKTLCNAL 157 >ref|XP_003523243.1| PREDICTED: uncharacterized protein LOC100526896 [Glycine max] Length = 263 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 HPDKHQGPSQAPAEEKFKQCVNAYKALCNAL 95 HPDKHQGPSQA AEEKFK CVNAYK LCNAL Sbjct: 230 HPDKHQGPSQAMAEEKFKLCVNAYKTLCNAL 260 >ref|XP_002522204.1| heat shock protein binding protein, putative [Ricinus communis] gi|223538575|gb|EEF40179.1| heat shock protein binding protein, putative [Ricinus communis] Length = 255 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 HPDKHQGPSQAPAEEKFKQCVNAYKALCNAL 95 HPDKHQGPSQA AEEKFK CVNAYK+LC+AL Sbjct: 224 HPDKHQGPSQAKAEEKFKLCVNAYKSLCDAL 254