BLASTX nr result
ID: Coptis21_contig00029209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029209 (434 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447853.1| hypothetical protein SORBIDRAFT_06g016980 [S... 60 1e-07 tpg|DAA37756.1| TPA: hypothetical protein ZEAMMB73_165571 [Zea m... 60 2e-07 tpg|DAA37755.1| TPA: hypothetical protein ZEAMMB73_165571 [Zea m... 60 2e-07 ref|XP_002528999.1| ATP-dependent RNA helicase, putative [Ricinu... 60 2e-07 ref|XP_004146280.1| PREDICTED: ATP-dependent RNA helicase Dhx29-... 60 2e-07 >ref|XP_002447853.1| hypothetical protein SORBIDRAFT_06g016980 [Sorghum bicolor] gi|241939036|gb|EES12181.1| hypothetical protein SORBIDRAFT_06g016980 [Sorghum bicolor] Length = 1240 Score = 60.5 bits (145), Expect = 1e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 433 ARQRRGRTGHVKPGICLCLYTHHRFDNLMHPYQ 335 A+QRRGR G VKPG+C CLYT HRF+N+M P+Q Sbjct: 991 AKQRRGRAGRVKPGLCFCLYTRHRFENIMRPFQ 1023 >tpg|DAA37756.1| TPA: hypothetical protein ZEAMMB73_165571 [Zea mays] Length = 1380 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 433 ARQRRGRTGHVKPGICLCLYTHHRFDNLMHPYQ 335 A+QRRGR G VKPG+C CLYT HRF+N+M P+Q Sbjct: 985 AKQRRGRAGRVKPGLCFCLYTRHRFENVMRPFQ 1017 >tpg|DAA37755.1| TPA: hypothetical protein ZEAMMB73_165571 [Zea mays] Length = 1185 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -2 Query: 433 ARQRRGRTGHVKPGICLCLYTHHRFDNLMHPYQ 335 A+QRRGR G VKPG+C CLYT HRF+N+M P+Q Sbjct: 985 AKQRRGRAGRVKPGLCFCLYTRHRFENVMRPFQ 1017 >ref|XP_002528999.1| ATP-dependent RNA helicase, putative [Ricinus communis] gi|223531539|gb|EEF33369.1| ATP-dependent RNA helicase, putative [Ricinus communis] Length = 1509 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = -2 Query: 433 ARQRRGRTGHVKPGICLCLYTHHRFDNLMHPYQ 335 ARQRRGR G VKPGIC CLYT HRF LM PYQ Sbjct: 1022 ARQRRGRAGRVKPGICFCLYTCHRFKKLMRPYQ 1054 >ref|XP_004146280.1| PREDICTED: ATP-dependent RNA helicase Dhx29-like [Cucumis sativus] Length = 1642 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = -2 Query: 433 ARQRRGRTGHVKPGICLCLYTHHRFDNLMHPYQ 335 ARQRRGR G V+PG C CLYTHHR++ LM P+Q Sbjct: 1207 ARQRRGRAGRVRPGTCFCLYTHHRYEKLMRPFQ 1239