BLASTX nr result
ID: Coptis21_contig00029185
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029185 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002322181.1| predicted protein [Populus trichocarpa] gi|2... 85 5e-15 ref|XP_004155086.1| PREDICTED: jmjC domain-containing protein 4-... 81 8e-14 ref|XP_004138273.1| PREDICTED: jmjC domain-containing protein 4-... 81 8e-14 ref|XP_002511357.1| transcription factor, putative [Ricinus comm... 81 8e-14 emb|CBI14986.3| unnamed protein product [Vitis vinifera] 77 1e-12 >ref|XP_002322181.1| predicted protein [Populus trichocarpa] gi|222869177|gb|EEF06308.1| predicted protein [Populus trichocarpa] Length = 553 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -3 Query: 140 ISYKEFTEKYLVKNEPVVLTGLMDDWKACKDWVTSEGKPNLHFFST 3 ISY EF E+YL KN+PVVLTGLMDDWKACKDWV GKPNL FFST Sbjct: 17 ISYNEFVERYLAKNQPVVLTGLMDDWKACKDWVFDSGKPNLKFFST 62 >ref|XP_004155086.1| PREDICTED: jmjC domain-containing protein 4-like [Cucumis sativus] Length = 480 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 140 ISYKEFTEKYLVKNEPVVLTGLMDDWKACKDWVTSEGKPNLHFFST 3 +SYKEF E+Y+ KN+PVVLTGLMDDWKAC DWV G+PNL FFST Sbjct: 17 LSYKEFVERYMEKNKPVVLTGLMDDWKACSDWVDENGQPNLSFFST 62 >ref|XP_004138273.1| PREDICTED: jmjC domain-containing protein 4-like [Cucumis sativus] Length = 480 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -3 Query: 140 ISYKEFTEKYLVKNEPVVLTGLMDDWKACKDWVTSEGKPNLHFFST 3 +SYKEF E+Y+ KN+PVVLTGLMDDWKAC DWV G+PNL FFST Sbjct: 17 LSYKEFVERYMEKNKPVVLTGLMDDWKACSDWVDENGQPNLSFFST 62 >ref|XP_002511357.1| transcription factor, putative [Ricinus communis] gi|223550472|gb|EEF51959.1| transcription factor, putative [Ricinus communis] Length = 462 Score = 81.3 bits (199), Expect = 8e-14 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -3 Query: 140 ISYKEFTEKYLVKNEPVVLTGLMDDWKACKDWVTSEGKPNLHFFST 3 +SY EF E+YL KN+PVVLTGLMD+W+ACKDWVT +G PNL FFST Sbjct: 17 LSYDEFVERYLSKNQPVVLTGLMDNWRACKDWVTDDGYPNLQFFST 62 >emb|CBI14986.3| unnamed protein product [Vitis vinifera] Length = 498 Score = 77.4 bits (189), Expect = 1e-12 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -3 Query: 140 ISYKEFTEKYLVKNEPVVLTGLMDDWKACKDWVTSEGKPNLHFFST 3 +SY +F E+YL+KN PVVL GLMD W+ACKDWVT G+PNL FFST Sbjct: 17 LSYSDFVERYLMKNRPVVLRGLMDGWRACKDWVTHTGQPNLEFFST 62