BLASTX nr result
ID: Coptis21_contig00029067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029067 (510 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72783.1| hypothetical protein VITISV_008016 [Vitis vinifera] 55 8e-06 >emb|CAN72783.1| hypothetical protein VITISV_008016 [Vitis vinifera] Length = 749 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = +2 Query: 329 LESQQLGIPKKSACKHRKYLPDVVVLKVPSGDVWRVEVKRVDENEVVWLQNGLQEFIEHH 508 L LGIPK+ ++ K L +++ LKVPSG VW+V +KR D VWL G +EF+E++ Sbjct: 34 LRDGTLGIPKRFVSRYGKNLSNIMFLKVPSGAVWQVGLKRGDGE--VWLDGGWREFVEYY 91