BLASTX nr result
ID: Coptis21_contig00028874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028874 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301659.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002301659.1| predicted protein [Populus trichocarpa] gi|222843385|gb|EEE80932.1| predicted protein [Populus trichocarpa] Length = 254 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +1 Query: 7 MSVDFQHLISLQDLELVWLPQLTSLPEEIQHARRLQTLEIEGCKNLRK 150 +S QHL L+DLELV P+L SLPE IQH L++L IEGC NL+K Sbjct: 185 LSEGVQHLTVLEDLELVNCPELNSLPESIQHLTSLRSLFIEGCPNLKK 232