BLASTX nr result
ID: Coptis21_contig00028770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00028770 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302909.1| cc-nbs-lrr resistance protein [Populus trich... 79 3e-13 ref|XP_002335004.1| cc-nbs-lrr resistance protein [Populus trich... 77 2e-12 ref|XP_002302928.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 ref|XP_002516740.1| leucine-rich repeat containing protein, puta... 74 1e-11 ref|XP_002302910.1| cc-nbs-lrr resistance protein [Populus trich... 73 3e-11 >ref|XP_002302909.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222844635|gb|EEE82182.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1075 Score = 79.3 bits (194), Expect = 3e-13 Identities = 40/86 (46%), Positives = 56/86 (65%) Frame = +3 Query: 3 KEKLRSLDLQFSKERQDDAREENRKKIECVLDGLQPHANLVELHVRDYEGNKFPSWMMSS 182 K L SL L ++ R +EN ++ VL+GLQPH+NL +L + Y G++FP+WMM+ Sbjct: 713 KTALLSLTLSWNGNRTKSVIQENSEE---VLEGLQPHSNLKKLMIWGYGGSRFPNWMMNL 769 Query: 183 NTALPNLVLLELSCCNQCLELPALGR 260 N LPNLV +ELS C C +LP LG+ Sbjct: 770 NMTLPNLVEMELSACPNCEQLPPLGK 795 >ref|XP_002335004.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832589|gb|EEE71066.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 851 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/89 (42%), Positives = 56/89 (62%), Gaps = 5/89 (5%) Frame = +3 Query: 9 KLRSLDLQFSKERQDDAREENRKKI-----ECVLDGLQPHANLVELHVRDYEGNKFPSWM 173 KL++ L + + + RK + E VL+GLQPH+NL +L + Y G++FP+WM Sbjct: 654 KLKTALLSLTLSWHGNGAPQQRKSVIQENNEEVLEGLQPHSNLKKLKIWGYGGSRFPNWM 713 Query: 174 MSSNTALPNLVLLELSCCNQCLELPALGR 260 M+ N LPNLV +ELS C+ C +LP LG+ Sbjct: 714 MNLNMTLPNLVEMELSACDHCEQLPPLGK 742 >ref|XP_002302928.1| predicted protein [Populus trichocarpa] gi|222844654|gb|EEE82201.1| predicted protein [Populus trichocarpa] Length = 475 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/74 (47%), Positives = 52/74 (70%) Frame = +3 Query: 39 KERQDDAREENRKKIECVLDGLQPHANLVELHVRDYEGNKFPSWMMSSNTALPNLVLLEL 218 ++R+ +E N + VL+GLQPH+NL +L + Y G++FP+WMM+ N LPNLV +EL Sbjct: 124 QQRKSVIQENNEE----VLEGLQPHSNLKKLRICGYGGSRFPNWMMNLNMTLPNLVEMEL 179 Query: 219 SCCNQCLELPALGR 260 S C+ C +LP LG+ Sbjct: 180 SACDHCEQLPPLGK 193 >ref|XP_002516740.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223544113|gb|EEF45638.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1104 Score = 73.9 bits (180), Expect = 1e-11 Identities = 40/85 (47%), Positives = 56/85 (65%) Frame = +3 Query: 3 KEKLRSLDLQFSKERQDDAREENRKKIECVLDGLQPHANLVELHVRDYEGNKFPSWMMSS 182 KE L+SL L +S+E +D + E VLDG QPH+NL +L +R Y+G+KF SWM + Sbjct: 712 KEDLKSLSLCWSREGEDSSNLS-----EEVLDGCQPHSNLKKLSIRKYQGSKFASWM--T 764 Query: 183 NTALPNLVLLELSCCNQCLELPALG 257 + +LPNLV +EL C++C LP G Sbjct: 765 DLSLPNLVEIELVDCDRCEHLPPFG 789 >ref|XP_002302910.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222844636|gb|EEE82183.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 1131 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/73 (47%), Positives = 48/73 (65%) Frame = +3 Query: 42 ERQDDAREENRKKIECVLDGLQPHANLVELHVRDYEGNKFPSWMMSSNTALPNLVLLELS 221 +R+ +EN ++ VLDGLQP + L L + Y G+KFP+WMM+ N LPNLV +ELS Sbjct: 734 QRRKSVIQENNEE---VLDGLQPPSKLKRLRILGYRGSKFPNWMMNLNMTLPNLVEMELS 790 Query: 222 CCNQCLELPALGR 260 C C +LP LG+ Sbjct: 791 ACANCDQLPPLGK 803