BLASTX nr result
ID: Coptis21_contig00026689
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026689 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521776.1| kinase, putative [Ricinus communis] gi|22353... 55 6e-06 >ref|XP_002521776.1| kinase, putative [Ricinus communis] gi|223538989|gb|EEF40586.1| kinase, putative [Ricinus communis] Length = 635 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = +3 Query: 240 SNSMVFERVLPGPCRMKCPHGPLPDSSRFCNNGVTCSSCETTFV 371 SN MVFE VLPGPCR CP G L S RFC+ G C C T V Sbjct: 282 SNLMVFEEVLPGPCRSVCPCGILVGSVRFCSQGHICEHCYTNTV 325