BLASTX nr result
ID: Coptis21_contig00026554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00026554 (205 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635166.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 83 2e-14 ref|XP_002329779.1| predicted protein [Populus trichocarpa] gi|2... 82 6e-14 ref|XP_004155648.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_004134955.1| PREDICTED: pentatricopeptide repeat-containi... 81 1e-13 ref|XP_002519063.1| pentatricopeptide repeat-containing protein,... 79 5e-13 >ref|XP_003635166.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g33760-like [Vitis vinifera] Length = 561 Score = 83.2 bits (204), Expect = 2e-14 Identities = 40/66 (60%), Positives = 48/66 (72%) Frame = -2 Query: 204 YYKQMRVMGLHQSNFTFTAVIKACADLSALGYGRVIHGHVLSSGLGEDLYIHAALITFYA 25 +Y++M + QSN+TFTAVIKACAD+SAL GR IH HVL G D ++ AALI FYA Sbjct: 104 FYRRMVADSIPQSNYTFTAVIKACADISALRIGRPIHSHVLVCGYDSDSFVQAALIAFYA 163 Query: 24 KSGDCG 7 KSGD G Sbjct: 164 KSGDVG 169 >ref|XP_002329779.1| predicted protein [Populus trichocarpa] gi|222870841|gb|EEF07972.1| predicted protein [Populus trichocarpa] Length = 585 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/64 (56%), Positives = 48/64 (75%) Frame = -2 Query: 204 YYKQMRVMGLHQSNFTFTAVIKACADLSALGYGRVIHGHVLSSGLGEDLYIHAALITFYA 25 +Y +M + + SN+TFT+VIK+CADLSAL +GRV+HGHVL G G D+Y+ AAL+ Y Sbjct: 98 FYSRMVLSNVSPSNYTFTSVIKSCADLSALKHGRVVHGHVLVHGFGLDVYVQAALVALYG 157 Query: 24 KSGD 13 K GD Sbjct: 158 KCGD 161 >ref|XP_004155648.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like [Cucumis sativus] Length = 663 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/64 (57%), Positives = 47/64 (73%) Frame = -2 Query: 204 YYKQMRVMGLHQSNFTFTAVIKACADLSALGYGRVIHGHVLSSGLGEDLYIHAALITFYA 25 +Y++M G QSN+TFT+VIKACADLSAL G+ IH HV+ G G D+Y+ AALI YA Sbjct: 176 FYRRMLFSGAPQSNYTFTSVIKACADLSALRLGKEIHSHVMVCGYGSDMYVQAALIALYA 235 Query: 24 KSGD 13 K+ D Sbjct: 236 KASD 239 >ref|XP_004134955.1| PREDICTED: pentatricopeptide repeat-containing protein At2g33760-like [Cucumis sativus] Length = 599 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/64 (57%), Positives = 47/64 (73%) Frame = -2 Query: 204 YYKQMRVMGLHQSNFTFTAVIKACADLSALGYGRVIHGHVLSSGLGEDLYIHAALITFYA 25 +Y++M G QSN+TFT+VIKACADLSAL G+ IH HV+ G G D+Y+ AALI YA Sbjct: 112 FYRRMLFSGAPQSNYTFTSVIKACADLSALRLGKEIHSHVMVCGYGSDMYVQAALIALYA 171 Query: 24 KSGD 13 K+ D Sbjct: 172 KASD 175 >ref|XP_002519063.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541726|gb|EEF43274.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 386 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/66 (51%), Positives = 49/66 (74%) Frame = -2 Query: 204 YYKQMRVMGLHQSNFTFTAVIKACADLSALGYGRVIHGHVLSSGLGEDLYIHAALITFYA 25 +Y M + + S +TFT+++K+CADLS+L G+V+HGHVL +G G D+Y+ AAL+ YA Sbjct: 98 FYNCMLLSDISPSAYTFTSIVKSCADLSSLKLGKVVHGHVLVNGFGLDVYVQAALVACYA 157 Query: 24 KSGDCG 7 KSGD G Sbjct: 158 KSGDLG 163