BLASTX nr result
ID: Coptis21_contig00025811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025811 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002299928.1| predicted protein [Populus trichocarpa] gi|2... 77 2e-12 ref|XP_002272410.1| PREDICTED: structural maintenance of chromos... 75 7e-12 ref|XP_002871691.1| structural maintenance of chromosomes family... 74 2e-11 ref|NP_197096.1| structural maintenance of chromosomes 5 [Arabid... 73 3e-11 ref|XP_002517770.1| structural maintenance of chromosomes 5 smc5... 70 2e-10 >ref|XP_002299928.1| predicted protein [Populus trichocarpa] gi|222847186|gb|EEE84733.1| predicted protein [Populus trichocarpa] Length = 974 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/68 (55%), Positives = 50/68 (73%) Frame = +1 Query: 4 DAGEIQRHRDRKEELEESISHLEGSIKFLLTEQRHFEDEAAKLRKQREDLSSNAQLEKKK 183 D GEI+R R RKEELEE++S LE +K L+TEQR ++E AKL KQRE++ N LE +K Sbjct: 528 DVGEIERLRCRKEELEEAVSALEEDLKLLMTEQRSIDEEEAKLHKQREEIVGNVTLEMRK 587 Query: 184 *HDMESRV 207 +ME+RV Sbjct: 588 RREMENRV 595 >ref|XP_002272410.1| PREDICTED: structural maintenance of chromosomes protein 5 [Vitis vinifera] gi|297736324|emb|CBI24962.3| unnamed protein product [Vitis vinifera] Length = 1051 Score = 74.7 bits (182), Expect = 7e-12 Identities = 39/68 (57%), Positives = 49/68 (72%) Frame = +1 Query: 4 DAGEIQRHRDRKEELEESISHLEGSIKFLLTEQRHFEDEAAKLRKQREDLSSNAQLEKKK 183 D GEI+R R +K+ELEE I LE + K L EQR EDEAAKL KQRE++ + QLEK+K Sbjct: 616 DTGEIERLRSKKKELEEIIDDLEENFKSLQIEQRLLEDEAAKLHKQREEIINTVQLEKRK 675 Query: 184 *HDMESRV 207 +ME+RV Sbjct: 676 RREMENRV 683 >ref|XP_002871691.1| structural maintenance of chromosomes family protein [Arabidopsis lyrata subsp. lyrata] gi|297317528|gb|EFH47950.1| structural maintenance of chromosomes family protein [Arabidopsis lyrata subsp. lyrata] Length = 1052 Score = 73.6 bits (179), Expect = 2e-11 Identities = 38/68 (55%), Positives = 51/68 (75%) Frame = +1 Query: 1 VDAGEIQRHRDRKEELEESISHLEGSIKFLLTEQRHFEDEAAKLRKQREDLSSNAQLEKK 180 VD GE++ R RKEELE+SIS +E + K L TEQR E+EAAKL K+RE++ + + LEKK Sbjct: 615 VDVGELENLRSRKEELEDSISFMEETHKSLQTEQRLLEEEAAKLHKEREEIVNVSHLEKK 674 Query: 181 K*HDMESR 204 K ++ESR Sbjct: 675 KRRELESR 682 >ref|NP_197096.1| structural maintenance of chromosomes 5 [Arabidopsis thaliana] gi|9755638|emb|CAC01791.1| putative protein [Arabidopsis thaliana] gi|332004841|gb|AED92224.1| structural maintenance of chromosomes 5 [Arabidopsis thaliana] Length = 1053 Score = 72.8 bits (177), Expect = 3e-11 Identities = 37/68 (54%), Positives = 51/68 (75%) Frame = +1 Query: 1 VDAGEIQRHRDRKEELEESISHLEGSIKFLLTEQRHFEDEAAKLRKQREDLSSNAQLEKK 180 VD GE+++ R RKEELE+SI +E + K L TEQR E+EAAKL K+RE++ + + LEKK Sbjct: 615 VDVGELEKLRSRKEELEDSILFMEETHKSLQTEQRRLEEEAAKLHKEREEIVNVSYLEKK 674 Query: 181 K*HDMESR 204 K ++ESR Sbjct: 675 KRRELESR 682 >ref|XP_002517770.1| structural maintenance of chromosomes 5 smc5, putative [Ricinus communis] gi|223543042|gb|EEF44577.1| structural maintenance of chromosomes 5 smc5, putative [Ricinus communis] Length = 1057 Score = 70.1 bits (170), Expect = 2e-10 Identities = 36/68 (52%), Positives = 50/68 (73%) Frame = +1 Query: 4 DAGEIQRHRDRKEELEESISHLEGSIKFLLTEQRHFEDEAAKLRKQREDLSSNAQLEKKK 183 D+GEI+R + RK EL+ES++ LE S K L EQR E+E A+L+K+RE++ SN Q EK+K Sbjct: 624 DSGEIERLKCRKHELQESVTALEESFKVLQREQRQLENEEAELQKEREEIISNVQHEKRK 683 Query: 184 *HDMESRV 207 DME+ V Sbjct: 684 RKDMENLV 691