BLASTX nr result
ID: Coptis21_contig00025495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025495 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA57169.1| TPA: hypothetical protein ZEAMMB73_490377 [Zea m... 57 1e-06 ref|XP_003607437.1| Cation proton exchanger [Medicago truncatula... 57 1e-06 ref|XP_003607428.1| Exostosin family protein-like protein [Medic... 57 1e-06 ref|XP_002458661.1| hypothetical protein SORBIDRAFT_03g037670 [S... 57 1e-06 gb|ACN25797.1| unknown [Zea mays] 57 1e-06 >tpg|DAA57169.1| TPA: hypothetical protein ZEAMMB73_490377 [Zea mays] Length = 497 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 397 ANLAKYSGHFLYSSPAQPLGPEDLAWRIDAG 305 +NL KYS HFLYSSPAQPLGPEDL WR+ AG Sbjct: 431 SNLVKYSRHFLYSSPAQPLGPEDLTWRMIAG 461 >ref|XP_003607437.1| Cation proton exchanger [Medicago truncatula] gi|355508492|gb|AES89634.1| Cation proton exchanger [Medicago truncatula] Length = 1198 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 394 NLAKYSGHFLYSSPAQPLGPEDLAWRIDAG 305 NLAKYS HFLYSSPAQPLGPEDL W++ AG Sbjct: 433 NLAKYSRHFLYSSPAQPLGPEDLVWKMMAG 462 >ref|XP_003607428.1| Exostosin family protein-like protein [Medicago truncatula] gi|355508483|gb|AES89625.1| Exostosin family protein-like protein [Medicago truncatula] Length = 502 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 394 NLAKYSGHFLYSSPAQPLGPEDLAWRIDAG 305 NLAKYS HFLYSSPAQPLGPEDL W++ AG Sbjct: 433 NLAKYSRHFLYSSPAQPLGPEDLVWKMMAG 462 >ref|XP_002458661.1| hypothetical protein SORBIDRAFT_03g037670 [Sorghum bicolor] gi|241930636|gb|EES03781.1| hypothetical protein SORBIDRAFT_03g037670 [Sorghum bicolor] Length = 499 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 397 ANLAKYSGHFLYSSPAQPLGPEDLAWRIDAG 305 +NL KYS HFLYSSPAQPLGPEDL WR+ AG Sbjct: 433 SNLVKYSRHFLYSSPAQPLGPEDLTWRMIAG 463 >gb|ACN25797.1| unknown [Zea mays] Length = 380 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 397 ANLAKYSGHFLYSSPAQPLGPEDLAWRIDAG 305 +NL KYS HFLYSSPAQPLGPEDL WR+ AG Sbjct: 314 SNLVKYSRHFLYSSPAQPLGPEDLTWRMIAG 344