BLASTX nr result
ID: Coptis21_contig00025089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025089 (1175 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC66595.1| hypothetical protein OsI_32811 [Oryza sativa Indi... 59 2e-06 >gb|EEC66595.1| hypothetical protein OsI_32811 [Oryza sativa Indica Group] Length = 667 Score = 58.9 bits (141), Expect = 2e-06 Identities = 27/48 (56%), Positives = 28/48 (58%) Frame = +3 Query: 1011 AGCAGRCGAVEISYPFGI*EGCFSPGFEISCNQSIPFLKQLNLQLVEI 1154 AGC G CG V I YPFGI GCF PG EI C PFL QL+ I Sbjct: 13 AGCPGNCGGVGIPYPFGIGAGCFRPGLEIICKNDAPFLAGSGNQLIPI 60