BLASTX nr result
ID: Coptis21_contig00025049
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00025049 (509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003525200.1| PREDICTED: peroxisome biogenesis protein 3-2... 63 3e-08 ref|XP_002281306.1| PREDICTED: peroxisome biogenesis protein 3-2... 62 5e-08 ref|XP_003530946.1| PREDICTED: peroxisome biogenesis protein 3-2... 60 2e-07 gb|ACU20085.1| unknown [Glycine max] 60 2e-07 gb|ACU17566.1| unknown [Glycine max] 60 2e-07 >ref|XP_003525200.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Glycine max] Length = 369 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 331 MFSIRNFWRRNKRKVFVTVGLLGSGYVLYKLYNGH 435 M S+R+FWRR++RKVFVTVG+LGSGY+LYKLY H Sbjct: 1 MLSVRDFWRRHRRKVFVTVGVLGSGYLLYKLYGAH 35 >ref|XP_002281306.1| PREDICTED: peroxisome biogenesis protein 3-2 [Vitis vinifera] gi|297734292|emb|CBI15539.3| unnamed protein product [Vitis vinifera] Length = 373 Score = 62.0 bits (149), Expect = 5e-08 Identities = 24/35 (68%), Positives = 33/35 (94%) Frame = +1 Query: 331 MFSIRNFWRRNKRKVFVTVGLLGSGYVLYKLYNGH 435 MFS+R+FWRR++RK+FV+VG+ GSGY+LYKLY+ H Sbjct: 1 MFSVRDFWRRHRRKIFVSVGVFGSGYLLYKLYDAH 35 >ref|XP_003530946.1| PREDICTED: peroxisome biogenesis protein 3-2-like [Glycine max] Length = 369 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 331 MFSIRNFWRRNKRKVFVTVGLLGSGYVLYKLY 426 M S+R+FWRR++RKVFVTVG+LGSGY+LYKLY Sbjct: 1 MLSVRDFWRRHRRKVFVTVGVLGSGYLLYKLY 32 >gb|ACU20085.1| unknown [Glycine max] Length = 369 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 331 MFSIRNFWRRNKRKVFVTVGLLGSGYVLYKLY 426 M S+R+FWRR++RKVFVTVG+LGSGY+LYKLY Sbjct: 1 MLSVRDFWRRHRRKVFVTVGVLGSGYLLYKLY 32 >gb|ACU17566.1| unknown [Glycine max] Length = 123 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = +1 Query: 331 MFSIRNFWRRNKRKVFVTVGLLGSGYVLYKLY 426 M S+R+FWRR++RKVFVTVG+LGSGY+LYKLY Sbjct: 1 MLSVRDFWRRHRRKVFVTVGVLGSGYLLYKLY 32