BLASTX nr result
ID: Coptis21_contig00024779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00024779 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515408.1| Ubiquitin carboxyl-terminal hydrolase, putat... 55 4e-06 >ref|XP_002515408.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] gi|223545352|gb|EEF46857.1| Ubiquitin carboxyl-terminal hydrolase, putative [Ricinus communis] Length = 551 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/41 (58%), Positives = 29/41 (70%) Frame = +3 Query: 3 ASQGYLLYYVQKTPCYKASEDLSCPQQSPRHDPFVPTPGCC 125 ASQ Y+++YVQKT YKA+EDLS R DPF+P GCC Sbjct: 511 ASQCYMIFYVQKTHYYKANEDLSRTSMPQRRDPFIPIAGCC 551