BLASTX nr result
ID: Coptis21_contig00024712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00024712 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532208.1| conserved hypothetical protein [Ricinus comm... 83 3e-14 ref|XP_003605254.1| hypothetical protein MTR_4g027190 [Medicago ... 82 5e-14 ref|XP_003601533.1| hypothetical protein MTR_3g082740 [Medicago ... 82 5e-14 ref|XP_003601531.1| hypothetical protein MTR_3g082720 [Medicago ... 82 5e-14 ref|XP_003619110.1| hypothetical protein MTR_6g042080 [Medicago ... 77 1e-12 >ref|XP_002532208.1| conserved hypothetical protein [Ricinus communis] gi|223528104|gb|EEF30177.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 82.8 bits (203), Expect = 3e-14 Identities = 37/77 (48%), Positives = 53/77 (68%) Frame = -3 Query: 236 HFLLIENLEKDLSPSAIVDFVTKHVSITSHAQVFPSLSSETYTRGIIAVDTQEELQKLSD 57 + L++NL+K LSPS I++F+ + ++ A VFPSLSSETYT G + V+ ++ QKLS+ Sbjct: 209 YIFLVDNLDKSLSPSTIMEFIHRLTLVSVRAYVFPSLSSETYTNGAVVVEGEKNFQKLSE 268 Query: 56 FLHDPGHIILSPRGIPW 6 F P HII+S G PW Sbjct: 269 FFDSPDHIIMSRGGRPW 285 >ref|XP_003605254.1| hypothetical protein MTR_4g027190 [Medicago truncatula] gi|355506309|gb|AES87451.1| hypothetical protein MTR_4g027190 [Medicago truncatula] Length = 307 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/76 (48%), Positives = 53/76 (69%) Frame = -3 Query: 230 LLIENLEKDLSPSAIVDFVTKHVSITSHAQVFPSLSSETYTRGIIAVDTQEELQKLSDFL 51 +LI NL+K+L PS V+F+ KH +++ +FPSLS E YTRG I + T+++ QKL DFL Sbjct: 151 ILIGNLDKELCPSTAVEFIYKHTQVSASVFIFPSLSLELYTRGAIMLHTEQDFQKLCDFL 210 Query: 50 HDPGHIILSPRGIPWM 3 +P +II S G PW+ Sbjct: 211 TNPNYIIASSTGRPWV 226 >ref|XP_003601533.1| hypothetical protein MTR_3g082740 [Medicago truncatula] gi|355490581|gb|AES71784.1| hypothetical protein MTR_3g082740 [Medicago truncatula] Length = 294 Score = 82.0 bits (201), Expect = 5e-14 Identities = 37/76 (48%), Positives = 53/76 (69%) Frame = -3 Query: 230 LLIENLEKDLSPSAIVDFVTKHVSITSHAQVFPSLSSETYTRGIIAVDTQEELQKLSDFL 51 +LI NL+K+L PS V+F+ KH +++ +FPSLS E YTRG I + T+++ QKL DFL Sbjct: 138 ILIGNLDKELCPSTAVEFIYKHTQVSASVFIFPSLSLELYTRGAIMLHTEQDFQKLCDFL 197 Query: 50 HDPGHIILSPRGIPWM 3 +P +II S G PW+ Sbjct: 198 TNPNYIIASSTGRPWV 213 >ref|XP_003601531.1| hypothetical protein MTR_3g082720 [Medicago truncatula] gi|355490579|gb|AES71782.1| hypothetical protein MTR_3g082720 [Medicago truncatula] Length = 685 Score = 82.0 bits (201), Expect = 5e-14 Identities = 38/76 (50%), Positives = 52/76 (68%) Frame = -3 Query: 230 LLIENLEKDLSPSAIVDFVTKHVSITSHAQVFPSLSSETYTRGIIAVDTQEELQKLSDFL 51 +L+ NL+K L PS V+F+ KH +++ +FPSLSSE YTRG I + T+ + QKL DFL Sbjct: 326 ILMGNLDKQLCPSTAVEFLYKHTQVSASVFIFPSLSSEIYTRGAIMLRTERDFQKLCDFL 385 Query: 50 HDPGHIILSPRGIPWM 3 +P HII S G PW+ Sbjct: 386 TNPKHIITSSTGRPWV 401 >ref|XP_003619110.1| hypothetical protein MTR_6g042080 [Medicago truncatula] gi|355494125|gb|AES75328.1| hypothetical protein MTR_6g042080 [Medicago truncatula] Length = 275 Score = 77.4 bits (189), Expect = 1e-12 Identities = 36/76 (47%), Positives = 51/76 (67%) Frame = -3 Query: 230 LLIENLEKDLSPSAIVDFVTKHVSITSHAQVFPSLSSETYTRGIIAVDTQEELQKLSDFL 51 +LI N++K+L PS V+F+ KH +++ +FPSLS E YTRG I T+++ QKL DFL Sbjct: 119 ILIGNVDKELCPSTAVEFLYKHTQVSASIFIFPSLSFEIYTRGAIMTHTEQDFQKLCDFL 178 Query: 50 HDPGHIILSPRGIPWM 3 D +II S G PW+ Sbjct: 179 TDQNYIITSLTGRPWV 194