BLASTX nr result
ID: Coptis21_contig00024706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00024706 (830 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001032026.1| casein kinase 2 subunit beta [Arabidopsis th... 66 8e-09 ref|NP_974896.1| casein kinase 2 subunit beta [Arabidopsis thali... 66 8e-09 tpg|DAA62803.1| TPA: hypothetical protein ZEAMMB73_706069 [Zea m... 65 2e-08 ref|XP_004138933.1| PREDICTED: putative casein kinase II subunit... 62 2e-07 gb|AEK26563.1| casein kinase II beta subunit [Populus tremula] g... 62 2e-07 >ref|NP_001032026.1| casein kinase 2 subunit beta [Arabidopsis thaliana] gi|332008085|gb|AED95468.1| casein kinase 2 subunit beta [Arabidopsis thaliana] Length = 253 Score = 66.2 bits (160), Expect = 8e-09 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 2 PRSSTVKIYCPKCEDIYYPRSKYQGSILHLLFSKETLLCI 121 PRSSTVKIYCPKCEDIYYPRSKYQGSI LFS +LL I Sbjct: 217 PRSSTVKIYCPKCEDIYYPRSKYQGSI---LFSTVSLLLI 253 >ref|NP_974896.1| casein kinase 2 subunit beta [Arabidopsis thaliana] gi|332008084|gb|AED95467.1| casein kinase 2 subunit beta [Arabidopsis thaliana] Length = 256 Score = 66.2 bits (160), Expect = 8e-09 Identities = 33/40 (82%), Positives = 34/40 (85%) Frame = +2 Query: 2 PRSSTVKIYCPKCEDIYYPRSKYQGSILHLLFSKETLLCI 121 PRSSTVKIYCPKCEDIYYPRSKYQGSI LFS +LL I Sbjct: 220 PRSSTVKIYCPKCEDIYYPRSKYQGSI---LFSTVSLLLI 256 >tpg|DAA62803.1| TPA: hypothetical protein ZEAMMB73_706069 [Zea mays] Length = 252 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +2 Query: 5 RSSTVKIYCPKCEDIYYPRSKYQGSILHLLFS 100 RSSTVKIYCPKCEDIYYPRSKYQGSIL +L S Sbjct: 207 RSSTVKIYCPKCEDIYYPRSKYQGSILTILLS 238 >ref|XP_004138933.1| PREDICTED: putative casein kinase II subunit beta-4-like [Cucumis sativus] gi|449505605|ref|XP_004162519.1| PREDICTED: putative casein kinase II subunit beta-4-like [Cucumis sativus] Length = 295 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 PRSSTVKIYCPKCEDIYYPRSKYQGSI 82 PRSSTVKIYCPKCEDIYYPRSKYQG+I Sbjct: 226 PRSSTVKIYCPKCEDIYYPRSKYQGNI 252 >gb|AEK26563.1| casein kinase II beta subunit [Populus tremula] gi|340007717|gb|AEK26564.1| casein kinase II beta subunit [Populus tremula] gi|340007719|gb|AEK26565.1| casein kinase II beta subunit [Populus tremula] Length = 125 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +2 Query: 2 PRSSTVKIYCPKCEDIYYPRSKYQGSI 82 PRSSTVKIYCPKCEDIYYPRSKYQG+I Sbjct: 58 PRSSTVKIYCPKCEDIYYPRSKYQGNI 84