BLASTX nr result
ID: Coptis21_contig00024516
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00024516 (222 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF17675.1|AC009243_2 F28K19.3 [Arabidopsis thaliana] 55 8e-06 >gb|AAF17675.1|AC009243_2 F28K19.3 [Arabidopsis thaliana] Length = 238 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/72 (40%), Positives = 41/72 (56%) Frame = +3 Query: 3 VQQLKDLVGRFDVDIVCLSETKASRERVEQLGKMLKFSGVFAVPAQGQSGGLAVLWKEDV 182 V++LK++ ++ D++CLSETK + V L FS VP+ G SGGL VLWK V Sbjct: 70 VRRLKEINRKYLPDVICLSETKQRNDYVRDTCCELGFSNFVMVPSMGLSGGLVVLWKPSV 129 Query: 183 ELEILGASRNQV 218 + + S N V Sbjct: 130 HISVSFNSPNLV 141