BLASTX nr result
ID: Coptis21_contig00024499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00024499 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78967.1| hypothetical protein VITISV_027273 [Vitis vinifera] 65 6e-09 >emb|CAN78967.1| hypothetical protein VITISV_027273 [Vitis vinifera] Length = 1163 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/64 (43%), Positives = 41/64 (64%) Frame = -2 Query: 195 KKNFYSCYTTYEERITHKPEQRSQQEWVNLVQFWDSPEHQVISERNKHNRSKQIAKHTSG 16 K +Y+ Y T EER+ +P S +W L+ FW +PE + IS++NK NR+KQ+ KHTS Sbjct: 923 KAKYYNPYNTDEERLCQRPPHLSDDDWRWLIHFWGTPEAKDISDKNKANRAKQVIKHTSR 982 Query: 15 RKGF 4 K + Sbjct: 983 SKSY 986