BLASTX nr result
ID: Coptis21_contig00023908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00023908 (691 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517253.1| conserved hypothetical protein [Ricinus comm... 62 1e-07 >ref|XP_002517253.1| conserved hypothetical protein [Ricinus communis] gi|223543624|gb|EEF45153.1| conserved hypothetical protein [Ricinus communis] Length = 416 Score = 62.0 bits (149), Expect = 1e-07 Identities = 35/70 (50%), Positives = 50/70 (71%), Gaps = 2/70 (2%) Frame = +1 Query: 487 SRKGLSLNSPRYVS--SPRVGGIRKSWISRSFQIVIVICLLLSFFLAIGCGYFYVFPSLS 660 ++K L++ SPR +S SPRV R S IS F +++VI LL+FF+AIG GY YV PSL+ Sbjct: 11 NQKVLNVGSPRSLSFGSPRVN--RSSLISHWFTVLVVIGSLLTFFIAIGGGYIYVLPSLT 68 Query: 661 LAIHGYGIAQ 690 A +G+GI++ Sbjct: 69 QAFYGFGISK 78