BLASTX nr result
ID: Coptis21_contig00022737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00022737 (468 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAL03676.1| RNA polymerase beta chain [Bowenia serrulata] 69 5e-10 ref|YP_007474667.1| RNA polymerase beta subunit (chloroplast) [C... 66 3e-09 gb|AFM54207.1| RpoB (chloroplast) [Zamia furfuracea] 66 3e-09 gb|ABU85267.1| RNA polymerase beta subunit [Cycas micronesica] 66 3e-09 ref|YP_001312184.1| RNA polymerase beta chain [Cycas taitungensi... 66 3e-09 >dbj|BAL03676.1| RNA polymerase beta chain [Bowenia serrulata] Length = 1072 Score = 68.6 bits (166), Expect = 5e-10 Identities = 37/54 (68%), Positives = 41/54 (75%), Gaps = 8/54 (14%) Frame = +1 Query: 7 PNNSIFALP---TPQD-----PLSQVLD*TNPLTQVVHRRKLSYLGPGGLTGRT 144 PNNS+ + P T QD PLSQ LD TNPLT++VHRRKLSYLGPGGLTGRT Sbjct: 354 PNNSVTSTPLTTTFQDFFGSHPLSQFLDQTNPLTEIVHRRKLSYLGPGGLTGRT 407 >ref|YP_007474667.1| RNA polymerase beta subunit (chloroplast) [Cycas revoluta] gi|372863143|gb|AEX99216.1| RNA polymerase beta subunit (chloroplast) [Cycas revoluta] Length = 1072 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 8/54 (14%) Frame = +1 Query: 7 PNNSIFALP---TPQD-----PLSQVLD*TNPLTQVVHRRKLSYLGPGGLTGRT 144 PNN + + P T QD PLSQ LD TNPLT++VHRRKLSYLGPGGLTGRT Sbjct: 354 PNNLVTSTPLTTTFQDFFGSHPLSQFLDQTNPLTEIVHRRKLSYLGPGGLTGRT 407 >gb|AFM54207.1| RpoB (chloroplast) [Zamia furfuracea] Length = 1078 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 8/54 (14%) Frame = +1 Query: 7 PNNSIFALP---TPQD-----PLSQVLD*TNPLTQVVHRRKLSYLGPGGLTGRT 144 PNN + + P T QD PLSQ LD TNPLT++VHRRKLSYLGPGGLTGRT Sbjct: 360 PNNLVTSTPLTTTFQDFFGSHPLSQFLDQTNPLTEIVHRRKLSYLGPGGLTGRT 413 >gb|ABU85267.1| RNA polymerase beta subunit [Cycas micronesica] Length = 1066 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 8/54 (14%) Frame = +1 Query: 7 PNNSIFALP---TPQD-----PLSQVLD*TNPLTQVVHRRKLSYLGPGGLTGRT 144 PNN + + P T QD PLSQ LD TNPLT++VHRRKLSYLGPGGLTGRT Sbjct: 348 PNNLVTSTPLTTTFQDFFGSHPLSQFLDQTNPLTEIVHRRKLSYLGPGGLTGRT 401 >ref|YP_001312184.1| RNA polymerase beta chain [Cycas taitungensis] gi|158513731|sp|A6H5F9.1|RPOB_CYCTA RecName: Full=DNA-directed RNA polymerase subunit beta; AltName: Full=PEP; AltName: Full=Plastid-encoded RNA polymerase subunit beta; Short=RNA polymerase subunit beta gi|149941501|dbj|BAF64925.1| RNA polymerase beta chain (chloroplast) [Cycas taitungensis] Length = 1072 Score = 66.2 bits (160), Expect = 3e-09 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 8/54 (14%) Frame = +1 Query: 7 PNNSIFALP---TPQD-----PLSQVLD*TNPLTQVVHRRKLSYLGPGGLTGRT 144 PNN + + P T QD PLSQ LD TNPLT++VHRRKLSYLGPGGLTGRT Sbjct: 354 PNNLVTSTPLTTTFQDFFGSHPLSQFLDQTNPLTEIVHRRKLSYLGPGGLTGRT 407