BLASTX nr result
ID: Coptis21_contig00022593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00022593 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27349.3| unnamed protein product [Vitis vinifera] 111 8e-23 ref|XP_002270106.1| PREDICTED: uncharacterized protein LOC100244... 111 8e-23 ref|XP_002526587.1| conserved hypothetical protein [Ricinus comm... 107 1e-21 ref|XP_003519313.1| PREDICTED: uncharacterized protein LOC100783... 106 2e-21 ref|NP_001240050.1| uncharacterized protein LOC100789581 [Glycin... 106 2e-21 >emb|CBI27349.3| unnamed protein product [Vitis vinifera] Length = 348 Score = 111 bits (277), Expect = 8e-23 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 190 MVGAVQFGVLAACVVLFVPMILAGWHLSRSKMLFFSGALFITLAVGVHLTPYFPSITNLL 11 MVG VQ GVLAACVVLFVPM +AGWHLSR+KMLFFSGALFITLAVGVHLTPYFPSI + L Sbjct: 29 MVGGVQLGVLAACVVLFVPMGMAGWHLSRNKMLFFSGALFITLAVGVHLTPYFPSIYDAL 88 Query: 10 SSL 2 SSL Sbjct: 89 SSL 91 >ref|XP_002270106.1| PREDICTED: uncharacterized protein LOC100244457 [Vitis vinifera] Length = 353 Score = 111 bits (277), Expect = 8e-23 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -3 Query: 190 MVGAVQFGVLAACVVLFVPMILAGWHLSRSKMLFFSGALFITLAVGVHLTPYFPSITNLL 11 MVG VQ GVLAACVVLFVPM +AGWHLSR+KMLFFSGALFITLAVGVHLTPYFPSI + L Sbjct: 1 MVGGVQLGVLAACVVLFVPMGMAGWHLSRNKMLFFSGALFITLAVGVHLTPYFPSIYDAL 60 Query: 10 SSL 2 SSL Sbjct: 61 SSL 63 >ref|XP_002526587.1| conserved hypothetical protein [Ricinus communis] gi|223534081|gb|EEF35799.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 107 bits (266), Expect = 1e-21 Identities = 50/63 (79%), Positives = 58/63 (92%) Frame = -3 Query: 190 MVGAVQFGVLAACVVLFVPMILAGWHLSRSKMLFFSGALFITLAVGVHLTPYFPSITNLL 11 M G VQ GVLAACVVLFVPM +AGWHLSR+KMLFFSGALFITLAVGVHLTPYFPS+++ + Sbjct: 1 MFGGVQLGVLAACVVLFVPMGMAGWHLSRNKMLFFSGALFITLAVGVHLTPYFPSVSDFV 60 Query: 10 SSL 2 +S+ Sbjct: 61 TSV 63 >ref|XP_003519313.1| PREDICTED: uncharacterized protein LOC100783987 [Glycine max] Length = 374 Score = 106 bits (265), Expect = 2e-21 Identities = 49/63 (77%), Positives = 60/63 (95%) Frame = -3 Query: 190 MVGAVQFGVLAACVVLFVPMILAGWHLSRSKMLFFSGALFITLAVGVHLTPYFPSITNLL 11 M+GAVQ G+LAACVVLFVPM +AGWHLSR+K+LFFSGALFITLAVGVHLTPYFPS+++ + Sbjct: 1 MLGAVQLGLLAACVVLFVPMGMAGWHLSRNKVLFFSGALFITLAVGVHLTPYFPSVSDFV 60 Query: 10 SSL 2 +S+ Sbjct: 61 TSV 63 >ref|NP_001240050.1| uncharacterized protein LOC100789581 [Glycine max] gi|255636963|gb|ACU18814.1| unknown [Glycine max] Length = 370 Score = 106 bits (265), Expect = 2e-21 Identities = 49/63 (77%), Positives = 60/63 (95%) Frame = -3 Query: 190 MVGAVQFGVLAACVVLFVPMILAGWHLSRSKMLFFSGALFITLAVGVHLTPYFPSITNLL 11 M+GAVQ G+LAACVVLFVPM +AGWHLSR+K+LFFSGALFITLAVGVHLTPYFPS+++ + Sbjct: 1 MLGAVQLGLLAACVVLFVPMGMAGWHLSRNKVLFFSGALFITLAVGVHLTPYFPSVSDFV 60 Query: 10 SSL 2 +S+ Sbjct: 61 TSV 63