BLASTX nr result
ID: Coptis21_contig00022513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00022513 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis tha... 59 4e-07 ref|YP_002608374.1| orf102 [Vitis vinifera] gi|209954171|emb|CAQ... 55 8e-06 >ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis thaliana] gi|45477063|sp|P92544.1|M1130_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg01130; AltName: Full=ORF106f gi|1785767|emb|CAA69797.1| unnamed protein product [Arabidopsis thaliana] Length = 106 Score = 58.9 bits (141), Expect = 4e-07 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 98 MIVTALQILFTLIRYVTETKFFRSVSVLFSDSEDEPAD 211 M+VTALQILF+LIRYVTET RSVSVLFSDSEDEP D Sbjct: 1 MMVTALQILFSLIRYVTET--IRSVSVLFSDSEDEPDD 36 >ref|YP_002608374.1| orf102 [Vitis vinifera] gi|209954171|emb|CAQ77618.1| orf102 [Vitis vinifera] gi|239764768|gb|ACS15237.1| ORF102 [Vitis vinifera] Length = 101 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 141 MSLKQSSSVLSLFYFRIPRMSRPILTSFMRSRTTE 245 MSLKQS VLSL YFRIPRMSRPILTSFMRS TT+ Sbjct: 1 MSLKQS--VLSLLYFRIPRMSRPILTSFMRSWTTK 33