BLASTX nr result
ID: Coptis21_contig00021463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00021463 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276633.2| PREDICTED: protein RRP5 homolog [Vitis vinif... 95 7e-18 emb|CBI29966.3| unnamed protein product [Vitis vinifera] 95 7e-18 ref|XP_003535096.1| PREDICTED: protein RRP5 homolog [Glycine max] 91 1e-16 ref|XP_003518021.1| PREDICTED: protein RRP5 homolog [Glycine max] 91 1e-16 ref|XP_002531584.1| programmed cell death protein, putative [Ric... 89 5e-16 >ref|XP_002276633.2| PREDICTED: protein RRP5 homolog [Vitis vinifera] Length = 1879 Score = 94.7 bits (234), Expect = 7e-18 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -3 Query: 264 VTLFQRALQYRDPEKVHLELLGMYERNEQRKLADELLDIMTKRFKHSCKVWLRLVQRL 91 V +FQRALQY DP+KVHL LLGMYER EQ KLADELL+ MTK+FKHSCKVWLR VQ + Sbjct: 1691 VKVFQRALQYCDPKKVHLALLGMYERTEQHKLADELLEKMTKKFKHSCKVWLRRVQNV 1748 >emb|CBI29966.3| unnamed protein product [Vitis vinifera] Length = 1862 Score = 94.7 bits (234), Expect = 7e-18 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -3 Query: 264 VTLFQRALQYRDPEKVHLELLGMYERNEQRKLADELLDIMTKRFKHSCKVWLRLVQRL 91 V +FQRALQY DP+KVHL LLGMYER EQ KLADELL+ MTK+FKHSCKVWLR VQ + Sbjct: 1674 VKVFQRALQYCDPKKVHLALLGMYERTEQHKLADELLEKMTKKFKHSCKVWLRRVQNV 1731 >ref|XP_003535096.1| PREDICTED: protein RRP5 homolog [Glycine max] Length = 1885 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = -3 Query: 258 LFQRALQYRDPEKVHLELLGMYERNEQRKLADELLDIMTKRFKHSCKVWLRLVQRL 91 +FQRALQY DP+KV+L LLGMYER EQ LADELL+ MTK+FKHSCKVWLR +Q L Sbjct: 1699 VFQRALQYNDPKKVYLALLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSL 1754 >ref|XP_003518021.1| PREDICTED: protein RRP5 homolog [Glycine max] Length = 2174 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/56 (75%), Positives = 48/56 (85%) Frame = -3 Query: 258 LFQRALQYRDPEKVHLELLGMYERNEQRKLADELLDIMTKRFKHSCKVWLRLVQRL 91 +FQRALQY DP+KV+L LLGMYER EQ LADELL+ MTK+FKHSCKVWLR +Q L Sbjct: 1988 VFQRALQYNDPKKVYLALLGMYERTEQHNLADELLNKMTKKFKHSCKVWLRRIQSL 2043 >ref|XP_002531584.1| programmed cell death protein, putative [Ricinus communis] gi|223528780|gb|EEF30787.1| programmed cell death protein, putative [Ricinus communis] Length = 1330 Score = 88.6 bits (218), Expect = 5e-16 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 258 LFQRALQYRDPEKVHLELLGMYERNEQRKLADELLDIMTKRFKHSCKVWLRLVQR 94 +FQRALQY DP+KVHL LLG+YER EQ KLADELLD M K+FK SCK+WLR VQR Sbjct: 1144 VFQRALQYCDPKKVHLALLGVYERTEQHKLADELLDRMVKKFKISCKIWLRRVQR 1198