BLASTX nr result
ID: Coptis21_contig00021433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00021433 (214 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527551.1| oxidoreductase, putative [Ricinus communis] ... 115 4e-24 ref|XP_002888640.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 114 1e-23 ref|NP_001077789.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 108 3e-22 ref|NP_001077790.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 108 3e-22 ref|NP_176975.2| 2-oxoglutarate (2OG) and Fe(II)-dependent oxyge... 108 3e-22 >ref|XP_002527551.1| oxidoreductase, putative [Ricinus communis] gi|223533101|gb|EEF34860.1| oxidoreductase, putative [Ricinus communis] Length = 397 Score = 115 bits (288), Expect = 4e-24 Identities = 52/64 (81%), Positives = 58/64 (90%) Frame = -3 Query: 194 HPRLIIHDFISLNLCKELEFIHKSCSTVGYRPNVFSTTLSHLIATNCGHLVLPFVSIRER 15 HPRLI+HDF+SL CKELEF+HKS STVGYRPNVFSTTLSHLIATNC H ++PFV IRER Sbjct: 8 HPRLILHDFLSLEECKELEFVHKSSSTVGYRPNVFSTTLSHLIATNCPHFIIPFVPIRER 67 Query: 14 LKDK 3 LK+K Sbjct: 68 LKEK 71 >ref|XP_002888640.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297334481|gb|EFH64899.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 389 Score = 114 bits (284), Expect = 1e-23 Identities = 53/67 (79%), Positives = 60/67 (89%) Frame = -3 Query: 203 ENPHPRLIIHDFISLNLCKELEFIHKSCSTVGYRPNVFSTTLSHLIATNCGHLVLPFVSI 24 E HPRLI+H+F+S CKELEFIHKSCST+GYRPNVFSTTLSHLIATN HL++PFVSI Sbjct: 3 EIEHPRLILHNFLSPAECKELEFIHKSCSTIGYRPNVFSTTLSHLIATNSPHLIIPFVSI 62 Query: 23 RERLKDK 3 RERLK+K Sbjct: 63 RERLKEK 69 >ref|NP_001077789.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] gi|71905465|gb|AAZ52710.1| expressed protein [Arabidopsis thaliana] gi|332196624|gb|AEE34745.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] Length = 339 Score = 108 bits (271), Expect = 3e-22 Identities = 51/67 (76%), Positives = 58/67 (86%) Frame = -3 Query: 203 ENPHPRLIIHDFISLNLCKELEFIHKSCSTVGYRPNVFSTTLSHLIATNCGHLVLPFVSI 24 E HPRLI+H+F+S CKELE IHKS ST+GYRPNVFSTTLSHLIATN HL++PFVSI Sbjct: 3 EKEHPRLILHNFLSPAECKELELIHKSSSTIGYRPNVFSTTLSHLIATNSPHLIIPFVSI 62 Query: 23 RERLKDK 3 RERLK+K Sbjct: 63 RERLKEK 69 >ref|NP_001077790.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] gi|71905463|gb|AAZ52709.1| expressed protein [Arabidopsis thaliana] gi|332196625|gb|AEE34746.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] Length = 369 Score = 108 bits (271), Expect = 3e-22 Identities = 51/67 (76%), Positives = 58/67 (86%) Frame = -3 Query: 203 ENPHPRLIIHDFISLNLCKELEFIHKSCSTVGYRPNVFSTTLSHLIATNCGHLVLPFVSI 24 E HPRLI+H+F+S CKELE IHKS ST+GYRPNVFSTTLSHLIATN HL++PFVSI Sbjct: 3 EKEHPRLILHNFLSPAECKELELIHKSSSTIGYRPNVFSTTLSHLIATNSPHLIIPFVSI 62 Query: 23 RERLKDK 3 RERLK+K Sbjct: 63 RERLKEK 69 >ref|NP_176975.2| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] gi|56236062|gb|AAV84487.1| At1g68080 [Arabidopsis thaliana] gi|58531340|gb|AAW78592.1| At1g68080 [Arabidopsis thaliana] gi|60547659|gb|AAX23793.1| hypothetical protein At1g68080 [Arabidopsis thaliana] gi|71905461|gb|AAZ52708.1| expressed protein [Arabidopsis thaliana] gi|332196623|gb|AEE34744.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] Length = 389 Score = 108 bits (271), Expect = 3e-22 Identities = 51/67 (76%), Positives = 58/67 (86%) Frame = -3 Query: 203 ENPHPRLIIHDFISLNLCKELEFIHKSCSTVGYRPNVFSTTLSHLIATNCGHLVLPFVSI 24 E HPRLI+H+F+S CKELE IHKS ST+GYRPNVFSTTLSHLIATN HL++PFVSI Sbjct: 3 EKEHPRLILHNFLSPAECKELELIHKSSSTIGYRPNVFSTTLSHLIATNSPHLIIPFVSI 62 Query: 23 RERLKDK 3 RERLK+K Sbjct: 63 RERLKEK 69