BLASTX nr result
ID: Coptis21_contig00021276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00021276 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22748.3| unnamed protein product [Vitis vinifera] 83 2e-14 ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containi... 83 2e-14 ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containi... 73 2e-11 ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 gb|AAF79508.1|AC002328_16 F20N2.6 [Arabidopsis thaliana] 68 7e-10 >emb|CBI22748.3| unnamed protein product [Vitis vinifera] Length = 518 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 1 IVYSTLVGNLKNAGKLSEAHEIITQMVDKGQYIHLLAKFKGYRRC 135 +VY+TLVGNL+NAGKL EAHE+I MVDKGQY+HLL+KFKGYRRC Sbjct: 474 LVYNTLVGNLRNAGKLKEAHEVIRHMVDKGQYVHLLSKFKGYRRC 518 >ref|XP_002268211.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Vitis vinifera] Length = 514 Score = 83.2 bits (204), Expect = 2e-14 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = +1 Query: 1 IVYSTLVGNLKNAGKLSEAHEIITQMVDKGQYIHLLAKFKGYRRC 135 +VY+TLVGNL+NAGKL EAHE+I MVDKGQY+HLL+KFKGYRRC Sbjct: 470 LVYNTLVGNLRNAGKLKEAHEVIRHMVDKGQYVHLLSKFKGYRRC 514 >ref|XP_004140840.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +1 Query: 1 IVYSTLVGNLKNAGKLSEAHEIITQMVDKGQYIHLLAKFKGYRRC 135 +VYSTLV L+NAGKL EAH++I QMV+ GQY HL+ KFKGYRRC Sbjct: 432 LVYSTLVSYLRNAGKLGEAHKVIKQMVENGQYAHLMTKFKGYRRC 476 >ref|XP_004157226.1| PREDICTED: pentatricopeptide repeat-containing protein At1g55630-like [Cucumis sativus] Length = 476 Score = 71.6 bits (174), Expect = 6e-11 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +1 Query: 1 IVYSTLVGNLKNAGKLSEAHEIITQMVDKGQYIHLLAKFKGYRRC 135 +VYSTLV L+NAGKL EAH++I +MV+ GQY HL+ KFKGYRRC Sbjct: 432 LVYSTLVSYLRNAGKLGEAHKVIKRMVENGQYAHLMTKFKGYRRC 476 >gb|AAF79508.1|AC002328_16 F20N2.6 [Arabidopsis thaliana] Length = 554 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +1 Query: 1 IVYSTLVGNLKNAGKLSEAHEIITQMVDKGQYIHLLAKFKGYRR 132 +VYSTLV NLKNAGK+ EAHE++ MV+KG Y+HL++K K YRR Sbjct: 510 VVYSTLVNNLKNAGKVLEAHEVVKDMVEKGHYVHLISKLKKYRR 553