BLASTX nr result
ID: Coptis21_contig00020919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00020919 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004170971.1| PREDICTED: SWI/SNF-related matrix-associated... 55 8e-06 ref|XP_004150074.1| PREDICTED: SWI/SNF-related matrix-associated... 55 8e-06 >ref|XP_004170971.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B-like [Cucumis sativus] Length = 903 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 4/50 (8%) Frame = +2 Query: 53 ECDHSFLLETDEGYVCQACGI----IKALFDYQREEGSKTTWTYMSEPQS 190 +C+HSFLL+ D GYVC+ CG+ I+ +F++Q +G K+T TY+SE ++ Sbjct: 286 DCEHSFLLKDDLGYVCRICGVIDRGIETIFEFQYNKGKKSTRTYISESRN 335 >ref|XP_004150074.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B-like [Cucumis sativus] Length = 903 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/50 (46%), Positives = 37/50 (74%), Gaps = 4/50 (8%) Frame = +2 Query: 53 ECDHSFLLETDEGYVCQACGI----IKALFDYQREEGSKTTWTYMSEPQS 190 +C+HSFLL+ D GYVC+ CG+ I+ +F++Q +G K+T TY+SE ++ Sbjct: 286 DCEHSFLLKDDLGYVCRICGVIDRGIETIFEFQYNKGKKSTRTYISESRN 335