BLASTX nr result
ID: Coptis21_contig00020452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00020452 (206 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526336.1| tRNA-splicing endonuclease subunit Sen2-2, p... 37 6e-06 ref|XP_002284873.1| PREDICTED: tRNA-splicing endonuclease subuni... 37 8e-06 >ref|XP_002526336.1| tRNA-splicing endonuclease subunit Sen2-2, putative [Ricinus communis] gi|223534295|gb|EEF36007.1| tRNA-splicing endonuclease subunit Sen2-2, putative [Ricinus communis] Length = 237 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +2 Query: 2 FYKAYSHTRTKIWVVRSGIQY 64 FYKAYSH R K WVVR G QY Sbjct: 121 FYKAYSHLRMKNWVVRPGSQY 141 Score = 37.4 bits (85), Expect(2) = 6e-06 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 72 HPSLVHSEYAVIV-SEGNGNKNTCLLAWPD 158 HPSLVHSEYAV+V SE + N N L W D Sbjct: 151 HPSLVHSEYAVLVLSEEDANANGRLRVWSD 180 >ref|XP_002284873.1| PREDICTED: tRNA-splicing endonuclease subunit Sen2-1 [Vitis vinifera] Length = 242 Score = 37.4 bits (85), Expect(2) = 8e-06 Identities = 19/30 (63%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Frame = +3 Query: 72 HPSLVHSEYAVIV-SEGNGNKNTCLLAWPD 158 HP+LVHSEYAV+V SE N N N L W D Sbjct: 151 HPALVHSEYAVLVLSEENENANGRLRVWSD 180 Score = 37.0 bits (84), Expect(2) = 8e-06 Identities = 16/21 (76%), Positives = 16/21 (76%) Frame = +2 Query: 2 FYKAYSHTRTKIWVVRSGIQY 64 FY AYSH R K WVVRSG QY Sbjct: 121 FYMAYSHLRIKNWVVRSGSQY 141