BLASTX nr result
ID: Coptis21_contig00020322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00020322 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323571.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002274657.1| PREDICTED: probable LRR receptor-like serine... 60 2e-07 ref|XP_002528112.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002323571.1| predicted protein [Populus trichocarpa] gi|222868201|gb|EEF05332.1| predicted protein [Populus trichocarpa] Length = 385 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/61 (52%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Frame = -2 Query: 175 MGLWCFGI---FKKNQERSIPNAENIQDITPDNVRVFPYKVLKSATGNFHPSNRLGRGGF 5 M CFG FK N P N Q I DNV +F Y L+SAT NFHPSNR+G GGF Sbjct: 1 MSCSCFGRSNWFKGNNHNDTPGQTNAQVIATDNVNLFSYNSLRSATRNFHPSNRIGGGGF 60 Query: 4 G 2 G Sbjct: 61 G 61 >ref|XP_002274657.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g53430 [Vitis vinifera] gi|297740219|emb|CBI30401.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -2 Query: 175 MGLWCFGIFKKNQERSIPNAENIQDITPDNVRVFPYKVLKSATGNFHPSNRLGRGGFG 2 MGL CFG F+ + + ++I +NVR+F Y L+SAT NFHPS+R+G GGFG Sbjct: 1 MGLNCFGAFEWCKGKKSLREPEAEEIATNNVRLFSYNSLRSATNNFHPSSRVGGGGFG 58 >ref|XP_002528112.1| conserved hypothetical protein [Ricinus communis] gi|223532501|gb|EEF34291.1| conserved hypothetical protein [Ricinus communis] Length = 318 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/54 (44%), Positives = 36/54 (66%) Frame = -2 Query: 163 CFGIFKKNQERSIPNAENIQDITPDNVRVFPYKVLKSATGNFHPSNRLGRGGFG 2 CF + + ++ + + ++I +NVRVF Y L+SAT +FHPSNR+G GGFG Sbjct: 5 CFNLLNSCKRKNRHSQQQTEEIVTNNVRVFSYNSLRSATKDFHPSNRIGGGGFG 58