BLASTX nr result
ID: Coptis21_contig00020295
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00020295 (604 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002446089.1| hypothetical protein SORBIDRAFT_06g001580 [S... 78 1e-12 ref|XP_002528106.1| mitochondrial inner membrane protease subuni... 77 2e-12 gb|AFW57676.1| hypothetical protein ZEAMMB73_249952 [Zea mays] g... 76 4e-12 ref|XP_004137724.1| PREDICTED: mitochondrial inner membrane prot... 76 5e-12 gb|ABK27122.1| unknown [Picea sitchensis] 76 5e-12 >ref|XP_002446089.1| hypothetical protein SORBIDRAFT_06g001580 [Sorghum bicolor] gi|241937272|gb|EES10417.1| hypothetical protein SORBIDRAFT_06g001580 [Sorghum bicolor] Length = 163 Score = 77.8 bits (190), Expect = 1e-12 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = +1 Query: 1 GRCWVEGDNXXXXXXXXXFGPIPLGLIQGKVTHIVWPPQRAGAIEKRMS*GRLLP 165 G CW+EGDN +GP+P+GL+QG+VTHI+WPPQR G ++++M GR++P Sbjct: 108 GHCWIEGDNAALSLDSRSYGPVPMGLLQGRVTHIIWPPQRIGRVDRKMPEGRIMP 162 >ref|XP_002528106.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] gi|223532495|gb|EEF34285.1| mitochondrial inner membrane protease subunit, putative [Ricinus communis] Length = 170 Score = 77.4 bits (189), Expect = 2e-12 Identities = 33/53 (62%), Positives = 38/53 (71%) Frame = +1 Query: 1 GRCWVEGDNXXXXXXXXXFGPIPLGLIQGKVTHIVWPPQRAGAIEKRMS*GRL 159 G CWVEGDN FGP+PLGLI G+VTHIVWPPQR G +EK++ GRL Sbjct: 115 GHCWVEGDNLLSSMDSRYFGPVPLGLISGRVTHIVWPPQRIGEVEKKIPQGRL 167 >gb|AFW57676.1| hypothetical protein ZEAMMB73_249952 [Zea mays] gi|413917745|gb|AFW57677.1| hypothetical protein ZEAMMB73_249952 [Zea mays] Length = 163 Score = 76.3 bits (186), Expect = 4e-12 Identities = 28/55 (50%), Positives = 41/55 (74%) Frame = +1 Query: 1 GRCWVEGDNXXXXXXXXXFGPIPLGLIQGKVTHIVWPPQRAGAIEKRMS*GRLLP 165 GRCWVEGDN +GP+P+GL++G+VTHI+WPP R G ++++M GR++P Sbjct: 108 GRCWVEGDNAATSFDSRSYGPVPMGLLRGRVTHIIWPPHRIGRVDRKMPEGRIVP 162 >ref|XP_004137724.1| PREDICTED: mitochondrial inner membrane protease subunit 2-like [Cucumis sativus] gi|449483475|ref|XP_004156603.1| PREDICTED: mitochondrial inner membrane protease subunit 2-like [Cucumis sativus] Length = 184 Score = 75.9 bits (185), Expect = 5e-12 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = +1 Query: 1 GRCWVEGDNXXXXXXXXXFGPIPLGLIQGKVTHIVWPPQRAGAIEKRMS*GRLLP 165 G CWVEGDN FGPIP+GLIQG+V+HIVWPPQR GA+EK+ G P Sbjct: 115 GHCWVEGDNPECSMDSRSFGPIPMGLIQGRVSHIVWPPQRIGAVEKKYPQGESNP 169 >gb|ABK27122.1| unknown [Picea sitchensis] Length = 170 Score = 75.9 bits (185), Expect = 5e-12 Identities = 31/56 (55%), Positives = 39/56 (69%) Frame = +1 Query: 1 GRCWVEGDNXXXXXXXXXFGPIPLGLIQGKVTHIVWPPQRAGAIEKRMS*GRLLPY 168 G CWVEGDN FGP+PLGL+QG+VTH++WPP+R GAIEK+ R+ Y Sbjct: 115 GHCWVEGDNAVSSLDSRSFGPVPLGLVQGRVTHVIWPPERVGAIEKQYPKERVSSY 170