BLASTX nr result
ID: Coptis21_contig00020156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00020156 (596 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136664.1| PREDICTED: uncharacterized protein At2g41620... 61 7e-12 ref|NP_565951.1| Nup93/Nic96 nucleoporin interacting component-c... 60 1e-11 ref|XP_002881785.1| nucleoporin interacting component family pro... 60 1e-11 ref|NP_191294.5| nuclear pore complex component Nup93/Nic96 doma... 56 1e-10 emb|CAB68141.1| putative protein [Arabidopsis thaliana] 56 2e-10 >ref|XP_004136664.1| PREDICTED: uncharacterized protein At2g41620-like [Cucumis sativus] gi|449494745|ref|XP_004159635.1| PREDICTED: uncharacterized protein At2g41620-like [Cucumis sativus] Length = 863 Score = 60.8 bits (146), Expect(2) = 7e-12 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +2 Query: 368 LQIRLRDYGVLDFDASDARRQPPLDTTWQLV 460 L+IRLRDYGVLDFDA+DARRQPP+DTTWQ + Sbjct: 321 LRIRLRDYGVLDFDANDARRQPPVDTTWQQI 351 Score = 34.7 bits (78), Expect(2) = 7e-12 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +1 Query: 187 QAAFGGAVGNLQRVRAFPRV 246 QAA GG VGNLQR+RAF R+ Sbjct: 304 QAALGGVVGNLQRIRAFLRI 323 >ref|NP_565951.1| Nup93/Nic96 nucleoporin interacting component-containing protein [Arabidopsis thaliana] gi|21542465|sp|O22224.2|Y2162_ARATH RecName: Full=Uncharacterized protein At2g41620 gi|14334432|gb|AAK59414.1| unknown protein [Arabidopsis thaliana] gi|20196948|gb|AAB84345.2| expressed protein [Arabidopsis thaliana] gi|21281026|gb|AAM44953.1| unknown protein [Arabidopsis thaliana] gi|330254914|gb|AEC10008.1| Nup93/Nic96 nucleoporin interacting component-containing protein [Arabidopsis thaliana] Length = 861 Score = 59.7 bits (143), Expect(2) = 1e-11 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 368 LQIRLRDYGVLDFDASDARRQPPLDTTWQLV 460 L+IRLRDYGVLDFD++DARRQPP+DTTWQ + Sbjct: 319 LRIRLRDYGVLDFDSTDARRQPPVDTTWQQI 349 Score = 35.0 bits (79), Expect(2) = 1e-11 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +1 Query: 187 QAAFGGAVGNLQRVRAFPRV 246 QAA GG+VGNLQR+RAF R+ Sbjct: 302 QAALGGSVGNLQRIRAFLRI 321 >ref|XP_002881785.1| nucleoporin interacting component family protein [Arabidopsis lyrata subsp. lyrata] gi|297327624|gb|EFH58044.1| nucleoporin interacting component family protein [Arabidopsis lyrata subsp. lyrata] Length = 855 Score = 59.7 bits (143), Expect(2) = 1e-11 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +2 Query: 368 LQIRLRDYGVLDFDASDARRQPPLDTTWQLV 460 L+IRLRDYGVLDFD++DARRQPP+DTTWQ + Sbjct: 313 LRIRLRDYGVLDFDSTDARRQPPVDTTWQQI 343 Score = 35.0 bits (79), Expect(2) = 1e-11 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +1 Query: 187 QAAFGGAVGNLQRVRAFPRV 246 QAA GG+VGNLQR+RAF R+ Sbjct: 296 QAALGGSVGNLQRIRAFLRI 315 >ref|NP_191294.5| nuclear pore complex component Nup93/Nic96 domain-containing protein [Arabidopsis thaliana] gi|332646124|gb|AEE79645.1| nuclear pore complex component Nup93/Nic96 domain-containing protein [Arabidopsis thaliana] Length = 860 Score = 56.2 bits (134), Expect(2) = 1e-10 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 368 LQIRLRDYGVLDFDASDARRQPPLDTTWQLV 460 L+IRLRDYG LDFD+ DARRQPP+DTTWQ + Sbjct: 317 LRIRLRDYGSLDFDSVDARRQPPVDTTWQQI 347 Score = 35.0 bits (79), Expect(2) = 1e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +1 Query: 187 QAAFGGAVGNLQRVRAFPRV 246 QAA GG+VGNLQR+RAF R+ Sbjct: 300 QAALGGSVGNLQRIRAFLRI 319 >emb|CAB68141.1| putative protein [Arabidopsis thaliana] Length = 875 Score = 55.8 bits (133), Expect(2) = 2e-10 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 368 LQIRLRDYGVLDFDASDARRQPPLDTTWQ 454 L+IRLRDYG LDFD+ DARRQPP+DTTWQ Sbjct: 330 LRIRLRDYGSLDFDSVDARRQPPVDTTWQ 358 Score = 35.0 bits (79), Expect(2) = 2e-10 Identities = 15/20 (75%), Positives = 18/20 (90%) Frame = +1 Query: 187 QAAFGGAVGNLQRVRAFPRV 246 QAA GG+VGNLQR+RAF R+ Sbjct: 313 QAALGGSVGNLQRIRAFLRI 332