BLASTX nr result
ID: Coptis21_contig00019984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019984 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632750.1| PREDICTED: probable FKBP-type peptidyl-proly... 59 5e-07 >ref|XP_003632750.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 1, chloroplastic isoform 2 [Vitis vinifera] Length = 215 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/53 (60%), Positives = 35/53 (66%), Gaps = 7/53 (13%) Frame = -2 Query: 139 ASAGIYICDVAGAVSTSRRAPRGVKIPERPDHNPPKWL-------EWKAITFM 2 A+AGIY+CDVAGAVSTSRRA RG KIPE P L +WK ITFM Sbjct: 73 AAAGIYVCDVAGAVSTSRRALRGAKIPESDYTTLPNGLKSVHYVAKWKGITFM 125