BLASTX nr result
ID: Coptis21_contig00019781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019781 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces ... 90 2e-16 ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidac... 87 1e-15 ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces... 87 1e-15 ref|ZP_09369757.1| hypothetical protein HMPREF0975_01540 [Actino... 85 7e-15 ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces... 83 3e-14 >ref|ZP_07286019.1| conserved hypothetical protein [Streptomyces sp. C] gi|302442572|gb|EFL14388.1| conserved hypothetical protein [Streptomyces sp. C] Length = 84 Score = 89.7 bits (221), Expect = 2e-16 Identities = 46/67 (68%), Positives = 51/67 (76%) Frame = +2 Query: 2 LSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTH 181 LSGRLPV ALV HYPTNKLI R I +RR+F P MQ +LSGI P F LSQS+GQ+ H Sbjct: 4 LSGRLPVVALVGHYPTNKLIGRGLILHRRSFQLPPMQAGVLSGIRPRFQGLSQSEGQIAH 63 Query: 182 VLLTRSP 202 VLLTRSP Sbjct: 64 VLLTRSP 70 >ref|ZP_08200493.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] gi|325947935|gb|EGD40054.1| hypothetical protein NBCG_05699 [Nocardioidaceae bacterium Broad-1] Length = 86 Score = 87.4 bits (215), Expect = 1e-15 Identities = 45/67 (67%), Positives = 52/67 (77%) Frame = +2 Query: 2 LSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTH 181 LSGRLPV+ALVSHY TNKLI RE IP R+ F MQ+ ++SGI+ F LSQS GQ+TH Sbjct: 6 LSGRLPVEALVSHYLTNKLIGREHIPGRKTFHNHPMQEVVVSGINHRFRWLSQSLGQITH 65 Query: 182 VLLTRSP 202 VLLTRSP Sbjct: 66 VLLTRSP 72 >ref|ZP_06706815.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] gi|292831588|gb|EFF89937.1| hypothetical protein SSTG_00255 [Streptomyces sp. e14] Length = 86 Score = 87.0 bits (214), Expect = 1e-15 Identities = 45/67 (67%), Positives = 51/67 (76%) Frame = +2 Query: 2 LSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTH 181 LSGRLPV ALVSHY TNKLI R I +RR+FP M + L+SGI P F LSQS+GQ+ H Sbjct: 6 LSGRLPVVALVSHYLTNKLIGRGLILHRRSFPASKMPRRLVSGIRPRFQGLSQSEGQIAH 65 Query: 182 VLLTRSP 202 VLLTRSP Sbjct: 66 VLLTRSP 72 >ref|ZP_09369757.1| hypothetical protein HMPREF0975_01540 [Actinomyces sp. oral taxon 849 str. F0330] gi|365264633|gb|EHM94433.1| hypothetical protein HMPREF0975_01540 [Actinomyces sp. oral taxon 849 str. F0330] Length = 255 Score = 84.7 bits (208), Expect = 7e-15 Identities = 43/72 (59%), Positives = 54/72 (75%), Gaps = 5/72 (6%) Frame = +2 Query: 2 LSGRLPVKALVSHYPTNKLISRESIPNRRN-----FPTPTMQQELLSGISPSFLKLSQSQ 166 LSGRLPV ALV H+PTNKLI RE IP+R++ FP P + + ISP+F++LS+ + Sbjct: 6 LSGRLPVTALVGHHPTNKLIGREPIPHRKHPKAQSFPNPPCDRPGIPRISPTFMRLSRRR 65 Query: 167 GQVTHVLLTRSP 202 GQVTHVLLTRSP Sbjct: 66 GQVTHVLLTRSP 77 >ref|ZP_06710336.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] gi|292835109|gb|EFF93458.1| hypothetical protein SSTG_03777 [Streptomyces sp. e14] Length = 86 Score = 82.8 bits (203), Expect = 3e-14 Identities = 44/67 (65%), Positives = 49/67 (73%) Frame = +2 Query: 2 LSGRLPVKALVSHYPTNKLISRESIPNRRNFPTPTMQQELLSGISPSFLKLSQSQGQVTH 181 LSGRLPV ALVS Y TNKLI R I +RR+FP M L+SGI P F LSQS+GQ+ H Sbjct: 6 LSGRLPVVALVSRYLTNKLIGRGLILHRRSFPASKMPWRLVSGIRPRFQGLSQSEGQIAH 65 Query: 182 VLLTRSP 202 VLLTRSP Sbjct: 66 VLLTRSP 72