BLASTX nr result
ID: Coptis21_contig00019612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019612 (414 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529455.1| proline synthetase associated protein, putat... 109 3e-22 ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed b... 109 3e-22 emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] 109 3e-22 ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed b... 105 5e-21 emb|CBI23205.3| unnamed protein product [Vitis vinifera] 105 5e-21 >ref|XP_002529455.1| proline synthetase associated protein, putative [Ricinus communis] gi|223531071|gb|EEF32921.1| proline synthetase associated protein, putative [Ricinus communis] Length = 245 Score = 109 bits (272), Expect = 3e-22 Identities = 50/57 (87%), Positives = 53/57 (92%) Frame = -1 Query: 414 SNCRAEVCKALGMTEEQCELSMGMSGDFEKAIEMGSTNVRIGSTIFGPREYPKKQGN 244 SNCR EVCKALGM E+ CELSMGMSGDFE+AIEMGSTNVR+GSTIFGPREYPKKQ N Sbjct: 189 SNCRLEVCKALGMAEDHCELSMGMSGDFEQAIEMGSTNVRVGSTIFGPREYPKKQSN 245 >ref|XP_002278892.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Vitis vinifera] gi|297737470|emb|CBI26671.3| unnamed protein product [Vitis vinifera] Length = 245 Score = 109 bits (272), Expect = 3e-22 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 411 NCRAEVCKALGMTEEQCELSMGMSGDFEKAIEMGSTNVRIGSTIFGPREYPKKQGN 244 NCR EVCKALGM EEQCELSMGMSGDFE+AIEMGSTNVRIGSTIFGPREYPKK+ N Sbjct: 190 NCRIEVCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKEQN 245 >emb|CAN80917.1| hypothetical protein VITISV_024616 [Vitis vinifera] Length = 245 Score = 109 bits (272), Expect = 3e-22 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 411 NCRAEVCKALGMTEEQCELSMGMSGDFEKAIEMGSTNVRIGSTIFGPREYPKKQGN 244 NCR EVCKALGM EEQCELSMGMSGDFE+AIEMGSTNVRIGSTIFGPREYPKK+ N Sbjct: 190 NCRIEVCKALGMAEEQCELSMGMSGDFEQAIEMGSTNVRIGSTIFGPREYPKKEQN 245 >ref|XP_002263767.2| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Vitis vinifera] Length = 264 Score = 105 bits (261), Expect = 5e-21 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -1 Query: 414 SNCRAEVCKALGMTEEQCELSMGMSGDFEKAIEMGSTNVRIGSTIFGPREYPKKQ 250 +NCR+EVCK+LG+TEEQCELSMGMSGDFE AIEMGSTNVRIGSTIFG REYPKKQ Sbjct: 208 ANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 262 >emb|CBI23205.3| unnamed protein product [Vitis vinifera] Length = 311 Score = 105 bits (261), Expect = 5e-21 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -1 Query: 414 SNCRAEVCKALGMTEEQCELSMGMSGDFEKAIEMGSTNVRIGSTIFGPREYPKKQ 250 +NCR+EVCK+LG+TEEQCELSMGMSGDFE AIEMGSTNVRIGSTIFG REYPKKQ Sbjct: 255 ANCRSEVCKSLGITEEQCELSMGMSGDFELAIEMGSTNVRIGSTIFGAREYPKKQ 309