BLASTX nr result
ID: Coptis21_contig00019528
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019528 (649 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517454.1| conserved hypothetical protein [Ricinus comm... 50 1e-08 >ref|XP_002517454.1| conserved hypothetical protein [Ricinus communis] gi|223543465|gb|EEF44996.1| conserved hypothetical protein [Ricinus communis] Length = 401 Score = 49.7 bits (117), Expect(2) = 1e-08 Identities = 38/119 (31%), Positives = 53/119 (44%), Gaps = 9/119 (7%) Frame = +1 Query: 133 SASSDQMENPKKESFEMSGLLSKLPNPIFIDILLRLPIKSLYRCLFLSKAWYHTIKHPSF 312 S + NP ESFE KLP I+ DIL R PI SL C +S+ WY ++++P Sbjct: 5 SGKEETSRNPGSESFE------KLPQEIYFDILSRQPIVSLLECKPVSRHWYTSVRNPLL 58 Query: 313 IEMYHDNKVINNNNTTPCF---------LIQVEVGRDFRLIDNESLDTFETPYNFLSSK 462 M H N+ N F L+QVE + L T +TP+ + S+ Sbjct: 59 ANM-HLNRAAEQNLCLLFFSDWPRSKLELVQVEHP------EPRKLKTLKTPFESVLSE 110 Score = 35.0 bits (79), Expect(2) = 1e-08 Identities = 25/58 (43%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = +2 Query: 491 SCNGLVFSTRRGFLYD---KEPYIICNPITGDHIVLPK---PPLHWIDRIVFGFGFDP 646 SCNGL+ LYD +P I NP T + LP+ P I R+VFGFGF P Sbjct: 116 SCNGLIC------LYDYFSDDPLYIYNPFTIECRELPRVEASPHSVICRVVFGFGFHP 167