BLASTX nr result
ID: Coptis21_contig00019324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00019324 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152379.1| PREDICTED: sec-independent protein transloca... 55 4e-06 >ref|XP_004152379.1| PREDICTED: sec-independent protein translocase protein TatB-like [Cucumis sativus] gi|449488644|ref|XP_004158126.1| PREDICTED: sec-independent protein translocase protein TatB-like [Cucumis sativus] Length = 239 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 5 KGSDIMLEAVLEAEVAQNAKQFFAQHQDQLKVE*E 109 KGSDIMLEAVLEAEVA NAK+FF+ HQ Q+K E E Sbjct: 205 KGSDIMLEAVLEAEVAHNAKEFFSSHQSQMKQEQE 239