BLASTX nr result
ID: Coptis21_contig00018868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018868 (594 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313030.1| predicted protein [Populus trichocarpa] gi|2... 76 4e-12 ref|XP_002512953.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 ref|XP_002283540.1| PREDICTED: uncharacterized protein LOC100248... 72 7e-11 gb|ADD09610.1| unknown [Trifolium repens] 64 2e-08 ref|XP_002868885.1| predicted protein [Arabidopsis lyrata subsp.... 58 1e-06 >ref|XP_002313030.1| predicted protein [Populus trichocarpa] gi|222849438|gb|EEE86985.1| predicted protein [Populus trichocarpa] Length = 92 Score = 76.3 bits (186), Expect = 4e-12 Identities = 38/69 (55%), Positives = 46/69 (66%), Gaps = 1/69 (1%) Frame = -1 Query: 378 RKGLSTYYTGKSQSFTSLADVHCLEDLKKPEIPQAKKR-KYLRRENTQIASVPCRTISNS 202 R GLS YY+GK++SFT +ADV CLEDLKKPE P KKR KY R + PCR +S+S Sbjct: 23 RGGLSRYYSGKARSFTCIADVRCLEDLKKPERPDPKKRQKYSDRNGLHVPPYPCRRVSSS 82 Query: 201 NHFAAPFVG 175 +P VG Sbjct: 83 TQCFSPCVG 91 >ref|XP_002512953.1| conserved hypothetical protein [Ricinus communis] gi|223547964|gb|EEF49456.1| conserved hypothetical protein [Ricinus communis] Length = 129 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 1/58 (1%) Frame = -1 Query: 378 RKGLSTYYTGKSQSFTSLADVHCLEDLKKPEIPQAKKR-KYLRRENTQIASVPCRTIS 208 ++GLS YY+GKS+SFT +ADVHCLEDLKK E P AKKR KY R + + PCR I+ Sbjct: 22 KRGLSRYYSGKSRSFTCMADVHCLEDLKKKEHPDAKKRKKYSERRDLHVPPYPCRRIA 79 >ref|XP_002283540.1| PREDICTED: uncharacterized protein LOC100248701 [Vitis vinifera] gi|297744434|emb|CBI37696.3| unnamed protein product [Vitis vinifera] Length = 91 Score = 72.0 bits (175), Expect = 7e-11 Identities = 35/69 (50%), Positives = 47/69 (68%), Gaps = 1/69 (1%) Frame = -1 Query: 378 RKGLSTYYTGKSQSFTSLADVHCLEDLKKPEIPQAKKR-KYLRRENTQIASVPCRTISNS 202 ++GLS YY+GK++SFTS+ADVHCLEDLKK E P AKKR K+ +R++ Q A C + Sbjct: 22 KRGLSRYYSGKARSFTSIADVHCLEDLKKKEHPAAKKRKKHSKRQDIQAAPYLCGRVPGG 81 Query: 201 NHFAAPFVG 175 P +G Sbjct: 82 TQCTTPCLG 90 >gb|ADD09610.1| unknown [Trifolium repens] Length = 93 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 2/69 (2%) Frame = -1 Query: 378 RKGLSTYYTGKSQSFTSLADVHCLEDLKKPEIPQAKKRKYL--RRENTQIASVPCRTISN 205 R GLS YY+GK++SF + DVH +EDLKKP+ P AKKRK R E + PCR + Sbjct: 23 RGGLSRYYSGKARSFVCMEDVHSVEDLKKPKHPDAKKRKKQSHRNEFINLNPYPCRRAPS 82 Query: 204 SNHFAAPFV 178 PFV Sbjct: 83 CTQLTTPFV 91 >ref|XP_002868885.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297314721|gb|EFH45144.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 108 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 20/87 (22%) Frame = -1 Query: 378 RKGLSTYYTGKSQSFTSLADVHCLEDLKKP--------EIPQAKKRKYLRRE-------- 247 ++GLS YY+GK++SF ++DV CLEDLKKP + KKRK ++ Sbjct: 21 KRGLSRYYSGKARSFICISDVKCLEDLKKPTQTFDDDDDDEAYKKRKKKNKQSSSSSFSA 80 Query: 246 ----NTQIASVPCRTISNSNHFAAPFV 178 N ++ PCR +S+S H ++P V Sbjct: 81 AINSNVNFSNYPCRRVSSSTHCSSPCV 107