BLASTX nr result
ID: Coptis21_contig00018791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018791 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa] 45 4e-06 >gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa] Length = 1384 Score = 45.4 bits (106), Expect(2) = 4e-06 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +3 Query: 33 REQVTNKVLQLQYVCTEDQVADILTKGLSTTRYSMLQQRLNVR 161 R++V + L + YV T DQ ADI TKGLST R+ L +L VR Sbjct: 1324 RDKVVRQELAVSYVSTADQTADIFTKGLSTQRFQFLASKLPVR 1366 Score = 30.0 bits (66), Expect(2) = 4e-06 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 1 TKHIEVDFHYIENKLL 48 TKHIEVD+HY+ +K++ Sbjct: 1313 TKHIEVDYHYVRDKVV 1328