BLASTX nr result
ID: Coptis21_contig00018786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018786 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003549298.1| PREDICTED: poly(rC)-binding protein 3-like [... 59 3e-07 ref|XP_002264417.1| PREDICTED: KH domain-containing protein At4g... 57 2e-06 emb|CAN82085.1| hypothetical protein VITISV_031054 [Vitis vinifera] 57 2e-06 ref|XP_002518248.1| Poly(rC)-binding protein, putative [Ricinus ... 56 3e-06 gb|AAG60186.1|AC084763_6 putative nucleic acid binding protein [... 55 5e-06 >ref|XP_003549298.1| PREDICTED: poly(rC)-binding protein 3-like [Glycine max] Length = 436 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 3/39 (7%) Frame = -2 Query: 110 PTPSSSSAEKRWPG---DSVFRLVVPVLKVGSIIGRKGE 3 PTP ++AEKRWPG VFRL+VPVLKVGSIIGRKGE Sbjct: 28 PTPDPAAAEKRWPGWPGHCVFRLIVPVLKVGSIIGRKGE 66 >ref|XP_002264417.1| PREDICTED: KH domain-containing protein At4g18375 isoform 1 [Vitis vinifera] Length = 466 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -2 Query: 110 PTPSSSSAEKRWPGDSVFRLVVPVLKVGSIIGRKGE 3 P P+S WPGD VFRL+VPVLKVGSIIGRKGE Sbjct: 63 PAPASEKKWPGWPGDCVFRLIVPVLKVGSIIGRKGE 98 >emb|CAN82085.1| hypothetical protein VITISV_031054 [Vitis vinifera] Length = 473 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = -2 Query: 110 PTPSSSSAEKRWPGDSVFRLVVPVLKVGSIIGRKGE 3 P P+S WPGD VFRL+VPVLKVGSIIGRKGE Sbjct: 63 PAPASEKKWPGWPGDCVFRLIVPVLKVGSIIGRKGE 98 >ref|XP_002518248.1| Poly(rC)-binding protein, putative [Ricinus communis] gi|223542595|gb|EEF44134.1| Poly(rC)-binding protein, putative [Ricinus communis] Length = 451 Score = 55.8 bits (133), Expect = 3e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -2 Query: 125 IKHRRPTPSSSSAEKRWPGDSVFRLVVPVLKVGSIIGRKGE 3 +++ P+ S+S+ WPGD VFRL+VPVLKVGSIIGRKG+ Sbjct: 41 VENPEPSASTSANWPGWPGDCVFRLIVPVLKVGSIIGRKGD 81 >gb|AAG60186.1|AC084763_6 putative nucleic acid binding protein [Oryza sativa Japonica Group] gi|31433543|gb|AAP55041.1| KH domain-containing protein, putative, expressed [Oryza sativa Japonica Group] gi|125532979|gb|EAY79544.1| hypothetical protein OsI_34673 [Oryza sativa Indica Group] gi|125575714|gb|EAZ16998.1| hypothetical protein OsJ_32483 [Oryza sativa Japonica Group] gi|215769329|dbj|BAH01558.1| unnamed protein product [Oryza sativa Japonica Group] Length = 458 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/36 (77%), Positives = 31/36 (86%), Gaps = 3/36 (8%) Frame = -2 Query: 101 SSSSAEKRWPG---DSVFRLVVPVLKVGSIIGRKGE 3 + ++A KRWPG DSVFRLVVPVLKVGSIIGRKGE Sbjct: 41 AEAAAAKRWPGWPGDSVFRLVVPVLKVGSIIGRKGE 76