BLASTX nr result
ID: Coptis21_contig00018770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018770 (1870 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Diant... 80 2e-12 dbj|BAJ10395.1| xyloglucan endotransglucosylase/hydrolase [Diant... 80 2e-12 ref|XP_002886262.1| hypothetical protein ARALYDRAFT_343582 [Arab... 79 3e-12 ref|XP_002526224.1| Xyloglucan endotransglucosylase/hydrolase pr... 79 3e-12 ref|NP_179470.1| xyloglucan:xyloglucosyl transferase [Arabidopsi... 79 4e-12 >dbj|BAJ10423.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus] Length = 281 Score = 80.1 bits (196), Expect = 2e-12 Identities = 36/67 (53%), Positives = 49/67 (73%) Frame = +2 Query: 1670 ADFLSNVDILFGKDHMNFSTDGTEVDLSLDTYTGSGFRSKSSFIYGKFEMQIKLVPGKSS 1849 A+F S DI FG +G ++ LSLD Y+GSGFRSK+ +++GK +MQIKLVPG S+ Sbjct: 20 ANFYSEFDITFGDGRARLLNNGDDLTLSLDKYSGSGFRSKNEYLFGKIDMQIKLVPGNSA 79 Query: 1850 GTVTTFY 1870 G+VTT+Y Sbjct: 80 GSVTTYY 86 >dbj|BAJ10395.1| xyloglucan endotransglucosylase/hydrolase [Dianthus caryophyllus] Length = 289 Score = 80.1 bits (196), Expect = 2e-12 Identities = 36/67 (53%), Positives = 50/67 (74%) Frame = +2 Query: 1670 ADFLSNVDILFGKDHMNFSTDGTEVDLSLDTYTGSGFRSKSSFIYGKFEMQIKLVPGKSS 1849 A+F S+ DI FG +G ++ LSLD Y+GSGFRSK+ +++GK +MQIKLVPG S+ Sbjct: 25 ANFYSDFDITFGDGRARVLNNGEDLTLSLDKYSGSGFRSKNEYLFGKIDMQIKLVPGNSA 84 Query: 1850 GTVTTFY 1870 G+VTT+Y Sbjct: 85 GSVTTYY 91 >ref|XP_002886262.1| hypothetical protein ARALYDRAFT_343582 [Arabidopsis lyrata subsp. lyrata] gi|297332102|gb|EFH62521.1| hypothetical protein ARALYDRAFT_343582 [Arabidopsis lyrata subsp. lyrata] Length = 304 Score = 79.3 bits (194), Expect = 3e-12 Identities = 37/72 (51%), Positives = 53/72 (73%) Frame = +2 Query: 1655 ITVCSADFLSNVDILFGKDHMNFSTDGTEVDLSLDTYTGSGFRSKSSFIYGKFEMQIKLV 1834 + V + D ++DI +G N ++GT ++L LD +GSGF+SK+ ++YGKF+MQIKLV Sbjct: 21 LVVHAKDLNQDIDITWGDGRGNILSNGTLLNLVLDQSSGSGFQSKAEYLYGKFDMQIKLV 80 Query: 1835 PGKSSGTVTTFY 1870 PG S+GTVTTFY Sbjct: 81 PGNSAGTVTTFY 92 >ref|XP_002526224.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis] gi|223534463|gb|EEF36165.1| Xyloglucan endotransglucosylase/hydrolase protein 22 precursor, putative [Ricinus communis] Length = 295 Score = 79.3 bits (194), Expect = 3e-12 Identities = 36/73 (49%), Positives = 53/73 (72%) Frame = +2 Query: 1652 TITVCSADFLSNVDILFGKDHMNFSTDGTEVDLSLDTYTGSGFRSKSSFIYGKFEMQIKL 1831 ++ V + +F +VDI +G + +G V LSLD +GSGF+SK+ +++GKF+MQ+KL Sbjct: 24 SLMVVAGNFYQDVDITWGDERGKMLNNGNVVTLSLDKASGSGFQSKNEYLFGKFDMQLKL 83 Query: 1832 VPGKSSGTVTTFY 1870 VPG S+GTVTTFY Sbjct: 84 VPGNSAGTVTTFY 96 >ref|NP_179470.1| xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] gi|38605535|sp|Q9ZV40.1|XTH21_ARATH RecName: Full=Probable xyloglucan endotransglucosylase/hydrolase protein 21; Short=At-XTH21; Short=XTH-21; Flags: Precursor gi|4185146|gb|AAD08949.1| xyloglucan endotransglycosylase, putative [Arabidopsis thaliana] gi|330251715|gb|AEC06809.1| xyloglucan:xyloglucosyl transferase [Arabidopsis thaliana] Length = 305 Score = 79.0 bits (193), Expect = 4e-12 Identities = 37/72 (51%), Positives = 51/72 (70%) Frame = +2 Query: 1655 ITVCSADFLSNVDILFGKDHMNFSTDGTEVDLSLDTYTGSGFRSKSSFIYGKFEMQIKLV 1834 + V DF ++DI +G N +GT ++L LD +GSGF+SK+ ++YGK +MQIKLV Sbjct: 21 LVVHGKDFNQDIDITWGDGRGNILNNGTLLNLGLDQSSGSGFQSKAEYLYGKVDMQIKLV 80 Query: 1835 PGKSSGTVTTFY 1870 PG S+GTVTTFY Sbjct: 81 PGNSAGTVTTFY 92