BLASTX nr result
ID: Coptis21_contig00018619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018619 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520687.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 ref|XP_002320367.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002320652.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002520687.1| conserved hypothetical protein [Ricinus communis] gi|223540072|gb|EEF41649.1| conserved hypothetical protein [Ricinus communis] Length = 313 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/44 (68%), Positives = 32/44 (72%) Frame = -3 Query: 205 VEDFYRAHRCLAERFDMLKSEPRTRLLTPLSSPFSTKYPSNKSM 74 VEDFYR HR LAER+D LKS+ RLLT L SPFS KY S K M Sbjct: 72 VEDFYRTHRSLAERYDQLKSDSGNRLLTTLGSPFSAKYQSQKFM 115 >ref|XP_002320367.1| predicted protein [Populus trichocarpa] gi|222861140|gb|EEE98682.1| predicted protein [Populus trichocarpa] Length = 221 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/47 (63%), Positives = 33/47 (70%) Frame = -3 Query: 205 VEDFYRAHRCLAERFDMLKSEPRTRLLTPLSSPFSTKYPSNKSMSPK 65 VEDFYRAHR LAER+D LKS+ RLL SPFSTK+ K MS K Sbjct: 66 VEDFYRAHRLLAERYDQLKSDSGNRLLATFGSPFSTKHRPEKLMSVK 112 >ref|XP_002320652.1| predicted protein [Populus trichocarpa] gi|222861425|gb|EEE98967.1| predicted protein [Populus trichocarpa] Length = 234 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/45 (60%), Positives = 31/45 (68%) Frame = -3 Query: 205 VEDFYRAHRCLAERFDMLKSEPRTRLLTPLSSPFSTKYPSNKSMS 71 VEDFYRAHR LAER+D LKS+ RLL PFSTK+ K +S Sbjct: 68 VEDFYRAHRSLAERYDQLKSDSGNRLLATFGLPFSTKHRPEKLLS 112