BLASTX nr result
ID: Coptis21_contig00018581
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018581 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617802.1| hypothetical protein MTR_5g095630 [Medicago ... 55 5e-06 ref|XP_002522764.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 gb|ACU20106.1| unknown [Glycine max] 55 8e-06 >ref|XP_003617802.1| hypothetical protein MTR_5g095630 [Medicago truncatula] gi|355519137|gb|AET00761.1| hypothetical protein MTR_5g095630 [Medicago truncatula] Length = 250 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 312 DEEGDGLLSAEELNKKFEDFIRKMKENIITEAQQHLIMV 196 +EE +LS EELNKKFEDFIRKMKE++ +A++HL+MV Sbjct: 212 EEEESSVLSTEELNKKFEDFIRKMKEDLRIDARRHLVMV 250 >ref|XP_002522764.1| conserved hypothetical protein [Ricinus communis] gi|223538002|gb|EEF39615.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 309 EEGDGLLSAEELNKKFEDFIRKMKENIITEAQQHLIMVS 193 E+ G+LS EELNKKFE+FIRKMKE I EAQQ L++V+ Sbjct: 208 EDEHGMLSVEELNKKFEEFIRKMKEEIRIEAQQQLVLVN 246 >gb|ACU20106.1| unknown [Glycine max] Length = 257 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/40 (67%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 312 DEEGDG-LLSAEELNKKFEDFIRKMKENIITEAQQHLIMV 196 +EEG+ +LS EELNKKFEDFIRKMKE++ EAQ+ L+MV Sbjct: 218 EEEGESCMLSTEELNKKFEDFIRKMKEDLRIEAQRQLVMV 257