BLASTX nr result
ID: Coptis21_contig00018533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018533 (477 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36901.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002269082.1| PREDICTED: programmed cell death protein 2-l... 62 6e-08 ref|XP_002465399.1| hypothetical protein SORBIDRAFT_01g037990 [S... 61 8e-08 ref|XP_003558112.1| PREDICTED: programmed cell death protein 2-l... 60 2e-07 gb|EEC75065.1| hypothetical protein OsI_11185 [Oryza sativa Indi... 60 2e-07 >emb|CBI36901.3| unnamed protein product [Vitis vinifera] Length = 431 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 241 SVKVFRCQLPRSNPYYSSEPPRYDNSEKPSCAGDQETSW 357 SVKVFRCQLPRSNP+YSSEPPR D ++KPS G + +W Sbjct: 170 SVKVFRCQLPRSNPFYSSEPPRGDGTDKPSGIGARLCNW 208 >ref|XP_002269082.1| PREDICTED: programmed cell death protein 2-like [Vitis vinifera] Length = 411 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +1 Query: 241 SVKVFRCQLPRSNPYYSSEPPRYDNSEKPSCAGDQETSW 357 SVKVFRCQLPRSNP+YSSEPPR D ++KPS G + +W Sbjct: 150 SVKVFRCQLPRSNPFYSSEPPRGDGTDKPSGIGARLCNW 188 >ref|XP_002465399.1| hypothetical protein SORBIDRAFT_01g037990 [Sorghum bicolor] gi|241919253|gb|EER92397.1| hypothetical protein SORBIDRAFT_01g037990 [Sorghum bicolor] Length = 415 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +1 Query: 241 SVKVFRCQLPRSNPYYSSEPPRYDNSEKPSCAGDQETSW 357 SVKVFRCQLPRSN +YS++PP+YD S+KP C G W Sbjct: 153 SVKVFRCQLPRSNTFYSAQPPKYDGSDKPLCPGAPVCHW 191 >ref|XP_003558112.1| PREDICTED: programmed cell death protein 2-like [Brachypodium distachyon] Length = 413 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/39 (66%), Positives = 29/39 (74%) Frame = +1 Query: 241 SVKVFRCQLPRSNPYYSSEPPRYDNSEKPSCAGDQETSW 357 SVKVFRCQLPRSN +YSSEPP + NS+ P CAG W Sbjct: 150 SVKVFRCQLPRSNTFYSSEPPTHTNSDMPLCAGASVCHW 188 >gb|EEC75065.1| hypothetical protein OsI_11185 [Oryza sativa Indica Group] Length = 419 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +1 Query: 241 SVKVFRCQLPRSNPYYSSEPPRYDNSEKPSCAGDQETSW 357 SVKVFRCQLPRSN +YSSEPP++++S+KP C G W Sbjct: 156 SVKVFRCQLPRSNAFYSSEPPKHNDSDKPLCPGAPVCHW 194