BLASTX nr result
ID: Coptis21_contig00018442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018442 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606284.1| Lysine histidine transporter [Medicago trunc... 72 4e-11 ref|XP_003539805.1| PREDICTED: lysine histidine transporter 1-li... 71 1e-10 ref|XP_002527443.1| amino acid transporter, putative [Ricinus co... 66 3e-09 ref|XP_002313644.1| proline transporter [Populus trichocarpa] gi... 66 3e-09 emb|CBI17091.3| unnamed protein product [Vitis vinifera] 64 1e-08 >ref|XP_003606284.1| Lysine histidine transporter [Medicago truncatula] gi|355507339|gb|AES88481.1| Lysine histidine transporter [Medicago truncatula] Length = 462 Score = 72.4 bits (176), Expect = 4e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 119 GPKWARYYVGPIQFAVCYGAVIGCTLLGGQCMKA 18 GP+W RY+VGPIQFAVCYGAV+ CTLLGGQCMKA Sbjct: 120 GPRWGRYFVGPIQFAVCYGAVVACTLLGGQCMKA 153 >ref|XP_003539805.1| PREDICTED: lysine histidine transporter 1-like [Glycine max] Length = 456 Score = 70.9 bits (172), Expect = 1e-10 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 119 GPKWARYYVGPIQFAVCYGAVIGCTLLGGQCMKA 18 GP W RY+VGPIQFAVCYGAV+ CTLLGGQCMKA Sbjct: 114 GPGWGRYFVGPIQFAVCYGAVVACTLLGGQCMKA 147 >ref|XP_002527443.1| amino acid transporter, putative [Ricinus communis] gi|223533178|gb|EEF34935.1| amino acid transporter, putative [Ricinus communis] Length = 456 Score = 66.2 bits (160), Expect = 3e-09 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 119 GPKWARYYVGPIQFAVCYGAVIGCTLLGGQCMKA 18 GP+W RY+VGP+QF VCYGAV+ TLLGGQCMKA Sbjct: 115 GPRWGRYFVGPVQFLVCYGAVVASTLLGGQCMKA 148 >ref|XP_002313644.1| proline transporter [Populus trichocarpa] gi|222850052|gb|EEE87599.1| proline transporter [Populus trichocarpa] Length = 455 Score = 65.9 bits (159), Expect = 3e-09 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 128 KLSGPKWARYYVGPIQFAVCYGAVIGCTLLGGQCMK 21 ++ G KW +Y+VGPIQF VCYGAV+ CTLLGGQCMK Sbjct: 111 QILGRKWGKYFVGPIQFMVCYGAVVACTLLGGQCMK 146 >emb|CBI17091.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 63.9 bits (154), Expect = 1e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 119 GPKWARYYVGPIQFAVCYGAVIGCTLLGGQCMK 21 GP+W +YYVGPIQF VCYGAV+ TLLGGQC+K Sbjct: 134 GPRWGQYYVGPIQFLVCYGAVVASTLLGGQCLK 166