BLASTX nr result
ID: Coptis21_contig00018352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018352 (450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEE60884.1| hypothetical protein OsJ_14550 [Oryza sativa Japo... 55 6e-06 >gb|EEE60884.1| hypothetical protein OsJ_14550 [Oryza sativa Japonica Group] Length = 89 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/44 (50%), Positives = 33/44 (75%) Frame = +1 Query: 151 VTRDIIFRQILVHIPAKTLSKLKCVSKTWNRRISDPWFVKLHLD 282 V D++F ILVH+P K+L++LKCVS++W + DP FV+ HL+ Sbjct: 24 VPDDVLFSNILVHLPVKSLARLKCVSRSWLAAVEDPAFVRRHLE 67