BLASTX nr result
ID: Coptis21_contig00018193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00018193 (605 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002871003.1| PWWP domain-containing protein [Arabidopsis ... 56 4e-06 >ref|XP_002871003.1| PWWP domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297316840|gb|EFH47262.1| PWWP domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 628 Score = 56.2 bits (134), Expect = 4e-06 Identities = 43/154 (27%), Positives = 67/154 (43%), Gaps = 35/154 (22%) Frame = -3 Query: 357 DIVWAKANDSNRYWPGSIIK------------RVNGKLLVSFFDCKTTNWIYDSEIRYFE 214 D+VWAK S +WPG +I + G LLV++F T W S+++ F Sbjct: 105 DLVWAKIR-SYPWWPGQVIDASVASKAAKKHFKKKGNLLVAYFGDCTFAWNNASQVKPFH 163 Query: 213 NNYMPIMLDIGGMKLRNAIDCALNEFVNRLTLEYSCAC-----------ENDGNEGRGLV 67 N+ + + R+AIDCAL+E R+ SC+C +N N G Sbjct: 164 QNFSQMQEQSNLAEFRDAIDCALDEVSRRVEFGLSCSCVSVEAYNKLKTQNIINAGIRED 223 Query: 66 KKV------------FEPAEALGFVCRMAVCPFF 1 +V FEPA+ + ++ R+A P + Sbjct: 224 SRVRYGGDKLSDAISFEPAKLMDYMKRLACFPSY 257