BLASTX nr result
ID: Coptis21_contig00017221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00017221 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513232.1| glycosyltransferase, putative [Ricinus commu... 56 3e-06 emb|CBI36602.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002271446.1| PREDICTED: GPI mannosyltransferase 3 [Vitis ... 55 8e-06 emb|CAN70801.1| hypothetical protein VITISV_008053 [Vitis vinifera] 55 8e-06 >ref|XP_002513232.1| glycosyltransferase, putative [Ricinus communis] gi|223547606|gb|EEF49100.1| glycosyltransferase, putative [Ricinus communis] Length = 537 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 264 HSFREVKRFFHAHFKVDRDLQAYVVVYS 181 HSFREV+RFFHAHFKVDRDLQA VV+Y+ Sbjct: 507 HSFREVRRFFHAHFKVDRDLQASVVIYA 534 >emb|CBI36602.3| unnamed protein product [Vitis vinifera] Length = 626 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 264 HSFREVKRFFHAHFKVDRDLQAYVVVYSSTEQ 169 HSF+E++RFFHAH KVDRDLQA VVVY+ T Q Sbjct: 595 HSFKEIRRFFHAHLKVDRDLQASVVVYAFTGQ 626 >ref|XP_002271446.1| PREDICTED: GPI mannosyltransferase 3 [Vitis vinifera] Length = 541 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 264 HSFREVKRFFHAHFKVDRDLQAYVVVYSSTEQ 169 HSF+E++RFFHAH KVDRDLQA VVVY+ T Q Sbjct: 510 HSFKEIRRFFHAHLKVDRDLQASVVVYAFTGQ 541 >emb|CAN70801.1| hypothetical protein VITISV_008053 [Vitis vinifera] Length = 499 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 264 HSFREVKRFFHAHFKVDRDLQAYVVVYSSTEQ 169 HSF+E++RFFHAH KVDRDLQA VVVY+ T Q Sbjct: 468 HSFKEIRRFFHAHLKVDRDLQASVVVYAFTGQ 499