BLASTX nr result
ID: Coptis21_contig00017164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00017164 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513301.1| ATP binding protein, putative [Ricinus commu... 53 5e-06 dbj|BAK07305.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 6e-06 >ref|XP_002513301.1| ATP binding protein, putative [Ricinus communis] gi|223547209|gb|EEF48704.1| ATP binding protein, putative [Ricinus communis] Length = 786 Score = 53.1 bits (126), Expect(2) = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 128 MEAEMRRLTMELKQTMDMYNTACKEAVSGSQ 220 MEAEMRRL +ELKQTMDMY+TACKEA++ Q Sbjct: 323 MEAEMRRLKLELKQTMDMYSTACKEALTAKQ 353 Score = 21.9 bits (45), Expect(2) = 5e-06 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = +1 Query: 229 KAVEFHQWKIND 264 KAVE H+W++ + Sbjct: 354 KAVELHRWRVEE 365 >dbj|BAK07305.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 575 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +2 Query: 128 MEAEMRRLTMELKQTMDMYNTACKEAVSGSQLDTRL 235 MEAEMRRL +ELKQTMDMY+TACKEA++ Q T L Sbjct: 319 MEAEMRRLRLELKQTMDMYSTACKEALTAKQKATEL 354