BLASTX nr result
ID: Coptis21_contig00017163
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00017163 (1208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265066.1| PREDICTED: uncharacterized protein LOC100260... 59 2e-06 >ref|XP_002265066.1| PREDICTED: uncharacterized protein LOC100260942 [Vitis vinifera] Length = 249 Score = 58.9 bits (141), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = +1 Query: 649 VLRDPNDDDLNTIQLLHAVSMGASVLPRDSADMPDGELTY 768 V R+ N +DLN +Q+LHAVSMGA VLP ++ D+PDGELTY Sbjct: 173 VKREANAEDLNVMQMLHAVSMGAGVLPSEAIDLPDGELTY 212