BLASTX nr result
ID: Coptis21_contig00016717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00016717 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003607536.1| hypothetical protein MTR_4g079320 [Medicago ... 63 3e-08 ref|XP_003521849.1| PREDICTED: putative DEAD-box ATP-dependent R... 55 5e-06 >ref|XP_003607536.1| hypothetical protein MTR_4g079320 [Medicago truncatula] gi|355508591|gb|AES89733.1| hypothetical protein MTR_4g079320 [Medicago truncatula] Length = 787 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/41 (75%), Positives = 36/41 (87%), Gaps = 1/41 (2%) Frame = -3 Query: 361 RNYKGGKK-HGIPNAHVPSEIKNPDQVRKRRQQQASKISYM 242 RNYKGGKK H +PNAHV SEIK+ DQ+RK RQ++ASKISYM Sbjct: 723 RNYKGGKKQHLMPNAHVRSEIKDMDQIRKERQKKASKISYM 763 >ref|XP_003521849.1| PREDICTED: putative DEAD-box ATP-dependent RNA helicase 29-like [Glycine max] Length = 778 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/41 (60%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -3 Query: 361 RNYKGGKK-HGIPNAHVPSEIKNPDQVRKRRQQQASKISYM 242 RN+KG KK H +PNAHV SEIK+ DQ+RK RQ +A+++SY+ Sbjct: 718 RNFKGSKKQHSMPNAHVRSEIKDMDQIRKERQTKANRVSYI 758