BLASTX nr result
ID: Coptis21_contig00016612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00016612 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003532146.1| PREDICTED: aspartic proteinase nepenthesin-1... 60 2e-07 >ref|XP_003532146.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Glycine max] Length = 488 Score = 60.1 bits (144), Expect = 2e-07 Identities = 37/90 (41%), Positives = 53/90 (58%), Gaps = 5/90 (5%) Frame = +1 Query: 160 FIVLVSLLCFG--EKSFAYG---RDEVSESIHQSTVHDIVVSTILPPKSCSSSTSFKDRR 324 F+ L L CF EKSFA+ D S ++HQ T H + +S++LP SCSSS K + Sbjct: 10 FVSLTILFCFSSLEKSFAFQTTKEDTESNNLHQYT-HLVHLSSLLPSSSCSSSA--KGPK 66 Query: 325 RMPLLKIVHRHGPCSGSFHPEGQKKRATTY 414 R L++VH+HGPCS + +G+ K T + Sbjct: 67 RKASLEVVHKHGPCSQLNNHDGKAKSKTPH 96