BLASTX nr result
ID: Coptis21_contig00016542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00016542 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAB92466.1| hypothetical protein [Oryza sativa Japonica Grou... 68 7e-10 ref|XP_003569320.1| PREDICTED: uncharacterized protein LOC100842... 68 7e-10 ref|XP_002455920.1| hypothetical protein SORBIDRAFT_03g027290 [S... 67 2e-09 gb|ACG25910.1| hypothetical protein [Zea mays] gi|414881757|tpg|... 67 2e-09 ref|NP_001132036.1| uncharacterized protein LOC100193445 [Zea ma... 67 2e-09 >dbj|BAB92466.1| hypothetical protein [Oryza sativa Japonica Group] gi|125526771|gb|EAY74885.1| hypothetical protein OsI_02774 [Oryza sativa Indica Group] gi|125571113|gb|EAZ12628.1| hypothetical protein OsJ_02539 [Oryza sativa Japonica Group] Length = 122 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 350 KHFERQGKPPFAYHSQYMAHLLSHGQLDGSG 258 KHF+RQGKPP+AYH+QYMAHLLSHGQLDGSG Sbjct: 92 KHFDRQGKPPYAYHAQYMAHLLSHGQLDGSG 122 >ref|XP_003569320.1| PREDICTED: uncharacterized protein LOC100842136 [Brachypodium distachyon] Length = 122 Score = 68.2 bits (165), Expect = 7e-10 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 350 KHFERQGKPPFAYHSQYMAHLLSHGQLDGSG 258 KHF+RQGKPP+AYH+QYMAHLLSHGQLDGSG Sbjct: 92 KHFDRQGKPPYAYHAQYMAHLLSHGQLDGSG 122 >ref|XP_002455920.1| hypothetical protein SORBIDRAFT_03g027290 [Sorghum bicolor] gi|241927895|gb|EES01040.1| hypothetical protein SORBIDRAFT_03g027290 [Sorghum bicolor] Length = 122 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 350 KHFERQGKPPFAYHSQYMAHLLSHGQLDGSG 258 KHF+RQGKPP+AYH+QY+AHLLSHGQLDGSG Sbjct: 92 KHFDRQGKPPYAYHAQYLAHLLSHGQLDGSG 122 >gb|ACG25910.1| hypothetical protein [Zea mays] gi|414881757|tpg|DAA58888.1| TPA: hypothetical protein ZEAMMB73_063892 [Zea mays] Length = 104 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 350 KHFERQGKPPFAYHSQYMAHLLSHGQLDGSG 258 KHF+RQGKPP+AYH+QY+AHLLSHGQLDGSG Sbjct: 74 KHFDRQGKPPYAYHAQYLAHLLSHGQLDGSG 104 >ref|NP_001132036.1| uncharacterized protein LOC100193445 [Zea mays] gi|194693262|gb|ACF80715.1| unknown [Zea mays] gi|195621156|gb|ACG32408.1| hypothetical protein [Zea mays] gi|414881756|tpg|DAA58887.1| TPA: hypothetical protein ZEAMMB73_063892 [Zea mays] Length = 122 Score = 67.0 bits (162), Expect = 2e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 350 KHFERQGKPPFAYHSQYMAHLLSHGQLDGSG 258 KHF+RQGKPP+AYH+QY+AHLLSHGQLDGSG Sbjct: 92 KHFDRQGKPPYAYHAQYLAHLLSHGQLDGSG 122